ELF( 4M4 ( TlCD\\@0 6QQ O @@( @0 fH!@P@Q?P1Р -L</Tlcd btcmain() returnedvc   ! X(@@T @@ 0/xcxc// P-P谍c -LM@PL00S @0 K080 0 0 0 KKxbBBr@P/00S 000/xb|Xd -LMPjP @$K0s <pP 0ooK0 0倳@P % d @ ֣ᷲ 0R(0R iK^OoB%(BedA@\ `P/0 !`8 00 (  , !/ b$cDcHc -L:P|0 !!X0`T0P0H000, !  !@@ b$cDcHc -LM R0S,pP(`P6P J뛶(KDK⟈@T ዔPቔ cz ` C^P`0 00CS  0@!@a0C0DKↈTDK@DKs@qTDKu[P WP ቔP PDK·@{PvPpqPP =:  8$ 0@ ld@@ld%(B A@8A@ D0-L@NP0,,IP0C K0h`0@ @ B%@ -t0L0: SX 88S!~0Y㺼$ KhN 00 xtc@B -1@0LPS@"@1 x4 `1Sʀ0!` 0    !B? SCp0 !! HD u< 80Jc|Xd- b$cDcHcA@c@@@B@0 P000/$@$ 0 P0 00/dPd@0 R0 0/ BQ 0Rtc -LM a0@S=pPp{P/ {P- {P P0000 8^pPKh`{Pp0p @* R P0RKhl@P8P0Kb@@@p@Еb@tc` @ @ -LM(PP壸 ?xL噸!7GgRP  G|tP0007107' 7@7+RJ7尔ᴤḄt e Ep`@& 6 0**C7(g ㏺ြ۶6 +{P J "0fv솟1$6@A @!! *!& 1 !&06#6$1@T60S 6 606fTDC 1Q @P *P$1)0C$1$|0!10C0 @P :i*$1*0C,$1|1,!P1c001 1 @P :5*$10C$1{ 1 @P :$1|U*0C$1{0! 10C01 @ P:$14U*0C$1{0! 10C01 @ P:$1T*0C$1{0! 10C01 @ P:$1T*0C$1{0! 10C01 @ P}:$1*0C$1{1! 10C11 @ Pk:$1)0C$1{3#@P&K#"K#K#K#K#K#K# K#K$p㔓3唣ß ! J 0 pPKT!>0 0C>0 0C JĢ: J묒: J딂: Jptb: J("P9 J200 |240 PU]pQ!K!Tp0 Jl7K$,2,B 40!0!>0>00!10B#6 !$1 03/0 03/03/ 03/0j /LL Lt1t! p1p! l1l!!l+j! 1"yH (K0p00 : ]J@@>> 0 DSBO|Xdtcᆳb@(wcAiPb@?cJd`@` )i[  0K KKp `0K KK,@>xPxY0(K!C@@ bcx@@c -`pL(M @P<Kw(D` @p [0< BS00\DK$0 O,0S00DK$0 ,00S40S040 <>Y4K, p-LMP`@`00 0 0000 0PP @Kpd Pl0$P P ,0`0(@4P00T0( KP80L0<0H0@0D0D0@0H0(0(0 00}@@@ &@ DS,gVE 0-L@SdK0hf 0-@LdD0 00-L@uP0 0 0000@(00 SP/o/tc 0-A0PL`0p$ 7/ 0`$ V008#8Kh/ 0-@LP00 3/05 `8#8K0h/ 0-p0LP@ TX00L00 S /o" K0hS0tvcbtc` p-L M`P@`0@0 q PB 00,R P, 305/`P Kph\0 P RP n\0@X0Kph @0R{ Kp4@@@AAtctvcb` 0-L@ }P0/o"K0hCD1c -LP@P}`P  3(00S Kh'D1c 0-LPd}@P074U   K0h   D1c 0-P0LP D0R08|}@P0U  K0htc` D1c 0-LP@f}@0b}P  T0 K0hD1c 0-LP@N}@0J}P T0 K0hD1c 0-L@6}P0 K0hD1c -T0LP H0`R8!}@P /o"Khtc` D1c 0-<0L@ 00R0$}P0 K0h|tc` D1c -0PP 0PRL|P 003/U@  \` 08#8$Kk/`P` 0 5/ $KkA0 0tc` D1c -L|P|@P0 0`6/,T0``6/0 0P5/,0`Kh/D1c -0L 0R|P~|U@ 0$ 0`6/3>``0$ 6/T0$ 0P5/?>`P$ 5/0$ 0P5/ 0$ `8#8Kh/tc` D1c -lLA|PX=|U@ 0$ ``6/T$ `0Kh/D1c/ -0 PLT@``0 6/``0 6/`0 Kh/ 0-LP@ @0 T000S 0d00h00p0x0l0x0K0h S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` tc@, -LM0PST@Be Sa 廊 ļ(0K0 p0*b7/pP 嫊 (@`0( `` 6/``< (6/``0 (6/``0 (6/``0 (6/``0 (6/``0 (6/``0 (6/0``S0  0 (6/``0 (6/ ``x0(6/``(0 6/``L0 (6/000S00(0 00$0 K@N@e@@b -`0 PLT@ 003/V V ,:  00 3/@ -LM00 f K\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -0LPT@ pX` X0S 00$ 3/@08`P#8$ 5/$Kkû@ -0pL`T@ PW W x岻00 3/`0V00 V0`` 6/$KkV`p00 7/@| 0-LM 00 K KK0 0 0K K -LP`ᓉ@PP00l had00 P0   0 0@@b -`SL@Pp  P `Kh虽0WPPP  P $勽VKh@6@ -L M@0@0 S 0K EP@oKtc -Lp@zPP 0S 0W    T   0`0  W R0 00W0S 0TV0 TV0 Kh$1cb 0-L@|y0P Rd T0@0@0000@0  T R0 TS00 @K0h[$1cb 0-L@y0P Rl0T00 00T0S0   T R0 K0h1$1cb 0-L@yy0P Rl0T   00 0  T R0 00T0S00 K0h$1cb 0o/xvc/ p-L M0@K`0$ PxuP 0 (xKpT6 0-0L@TK0h{=$0dP 5/0 dP5/0Ѱ0ΰ0 K0hɰxvcp?>[@ p-L MP$@X1PP埼HD1D0: S#0!01  00 !0,0 5 W0 !00V0$  ( 4000 `0@ 6/0P Kph.   A4 00  f/0$ ,0 0( 000` PL{08 8Kphguxvc@tc,bpAp@9 @@\6 \ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc 0-L@+0 -1LP@`TKh衻0 dp7/U  `U \U% U U RU 0 dP5/U|0dP 5/0 4P5/ Kh?xvcz?>[@ 0-0L@TxxYP0PP0 4P5/ 0 4P5/P xvc?>[@ -LM1p@T.K:0` dP5/0 dP5/P 0P ,P 4p 40K1dp 7/0 4p7/ 0 4p7/ 0 4p7/(0KPU 岯尯宯0 dP5/$0 @?L$ xvc[@?> -1Lp@TP0` dP5/0 dP5/ vt偯㨲0dP 5/0 4P5/ 㗲0 4P5/ 0 4P5/PNxvc?>@ -L M01@P@p(@,=0:4700 ,Ϯ(̮0ɮ4Ʈ$" / V`0!  O( K( G`VP0  (奮 ,墮0埮04圮(Ko[xvc0 S-L S S Kh KhM@0 @o/tc -L M@PK -@2L`RpP0CRe*p2R 3C7CR0 0 $KkC42RX 3C7CR008#8S800 0? &?004004 0$0PL00 0( Q 00 15%0c ( \ 001X0 0(0%5 0(0hl60d007101000XP008#8S308#8S0xP0 pk?(P8p l<e?00500`P5008#8Sq308#8SkSW HdHd@8B @ p-LM@`P@d >\0\ ,K0,0 L0 P (0 D0$0 t08 8P(2Kp?>b,?>b`D D @ -L밴 0-Lބ@ᗴ000: S/vtc?>b00@o/tc` [ -@H2LPR] 37R 0Kh2RV 3C7CR008#8S800 0> &> 1414$00P L0$1 P00151c$  \ 001X0$0 05$0 0h l 60d0070 00000 !!008#8S008#8S308#8S0x`0 ppn>(`8p H<h>151``5008#8Sx3HHd@8B @ p-LM@`P@d \0\ ,K0,0 L0 P (0 D0$0 s08 8P(>Kp?>b,?>Xb0H LH @ -L -Lz0 0R/  itc` ?>xb 0-@0 LR + R= RV !0 1dPa05/|1|!dP 5/h1dP`! 5/<dP H!5/{0d4! K0h/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/0/-/-/-/-/-/-/ -LPpN`@P N/l0 2/ p 00S 0@0 @0000@ -L$MP@`~Ҷ08 K0 0  p7/0P *4 K * p7/0P 0 K "( p7/ Pp80@040 0000D1 R `, K  P  K,@0X@p0$0d0 ! S 01 0 0S0h006Qd  G|0000 100 0(0K00 8/,0$0(00\0` d$,@@@@c@@|vc@ *A 0 /|vc/$ R/P// -LM`0SPp @(( K )@P#(d@   !  S 0100 D0 (G0( 0Q05/(000@@ K0S   00C0/$ R |R R  /\ R T0R//! !  / _W@@W@AW@EW$QP    R"%"// -L'jo@ 0-@L(00 SK0hK0h]tc -Q@L`@@DT@ 0S 0S 0 TڒHpT P@T@p׭02  -L@ᘁP@i0 00`000`` `0 P0hPᶵ0 ^Plᬵ0d TPDᢵ0@ JPKh薵@@>vcR @R S PS -LMA Kh~ -LD Khu 0-L;0@ 0l0 0K0he 0-L+@^ Z0 000P/Qvc 0-D0L@T0P D0 00 K0h;vc0P/Q2vc 0-0LPU0 0S S+ S+ P@0@ 0 00 P @T 0 @X0P0000C00 0@,0P @@vcRW SW 0o/vc///@0Q 1CQ -1CQ /00// W@ 0-PLP2S y@@uPP,k0 -LM`}@p3`0PJXpl`R a0* Ru2 0P0 0 0-000 00!002 02 02h00x"6Pd兴0 0$pi0 0(i0SRp0STP@1 IP @1AP@1 9P@|1 1p10S h \90<0 h080 D10@ 40 X8!<Kod(K S1-p 0P0 000 00 000 0 000p 0pp0x g0* R 0@p S @ 0vc@tcY h@>_a`bY @` l] 4U Y U b bb0>-b] -L// -(cL@`qWʀ 0! `!"0""   !P0S& 㪫P0S+P0SPP0SW( ]0T S00Q0R  P0L"00 Qh 0J0x VbP0y < W o0S N fP0p P ,0S -0S( !#0x .P0p CP Q 0R(0l0 S$00 S YX0S`P\ d8$0PX0@ 0O_ 0!H `q0< 4   !^ b$cDcHcvc|b -\0P@0`0\00`@pLX0`0s X 0\00ުvc' 0-L@0__P0 -L0 @o/tc//0000/QR R / / 0-<0L@0: S0? K0htc 0-LM@(PKcT 匪@T 0(P 0S0\ 0S*0QR0 S!CK0'VUUU\ `P/0 !`8 00 (  , !/ b$cDcHc// 0-LM0@P K1p00 K200ߞp0000 000000000 K0Şp000K0 0!< 0`4 0 (   !/ b$cDcHc -`QL@p`SPPW Da la `a a b 0S0<000S0;Ua b (b 0b a 8b @b Hb Pb b Xb `b hb pb |b  0 00000 0 0000 000(020<0F0P0Z0d000000U񟗱b b b b 000000000000 -LP@`0  00CS0 00Q0 SK -L M@0 P ox rRP|`P PxP`Z  RL t0S 0S ʌ P00 0S0.U01 StPX` P> 00S p0S8Y0S3U _2x0: S1 M4\Sڀ KGSW`@PU 4 94 h PZP P0S00S Y U  0y|0S4 Q  |`0SVP * Rd d I pFA 0 M 00 0CM R00V0S P 0 A(Ko` (KHE>tc|b:XE> -LMpK|`@ pǰ>\4P \6\ \ p10: SRZ e0s(彤庤@(1 B@1 <P0P0PP0 00@J0 @C0 @<0 @5|0( K(0 p0p 0 h0$@ kP < D00[K@@i i tch Di ` Pb$@s#|b -L 0-L@< 0 0K0h[|b -L0 @o/tc )-LℤP0% Kh2 p-L MP`{@ aP0F.0 P05/PP Kph赯#t0 @#㘣 )@L0 )㎣40 dP5/Kph2@@`@H@j j  -L -L// p-L MP`;{P@ 1x0: S)Q0|0ɣ|ƣ@0 xNPt+ 04@800<00@00D00H00P Kt岢0t0Kp0|0!00坣|嚣0 P,Kph.tcl h@j l l ll @@ -L|ɣ -Lxo 0-@Lxᒾ0 0-L@ 00* R0l S嵣Q z @0(00* R  S宣tc` @!ƠC9 : \S0@-h0@1X040 4 004040C@P@CL00L000 bbPb -@ ML, u$0B 0N?mKm @@-0tt@T h# 000S (0S Q . 0S"bvc -P@L VPU`p,@0S* 0 QP WVQ00S  kP dL@\巍`PP偮 f`4``vc@@-@ -t0LP@T ` ` &0`0ፍ@P X T@ bvc 0-LM@K K$KPgP K0 +~K0 0-LM@K K$KPSP K0 +~K0 -p0LM 0 x0KR@P d` R MPK K,K.P  K0P 00~btb 0-LM@K K$KPP K0 6~K0 -LM@K K$KP K L~K -PLP@`aVʀ 0! `! 0    !0 2/P 0!H `a0< 4  , !Cvc b$cDcHc 0-T0LP@PQ0 P 0 3/,0  0K0h/vc -T0LP0S@@P  B  R `6/U000vcb -pL M`Pܠ܀}P@ P' P% PU PE`F@P P #P `PT00 R0SP0 0 @`P(K@RAT@X@/ -L M00\ @T   4/Kvc00S/ R//vc00S/ R//vc -P`<@Le/ Kb_/080Kh/vc - 0L@ S(@0` !P0 R  P TP X00S0@@@P @00 , !b @0-L@p !P`0S"P ( R00 @T P # 0SHH@`A`0 !! R00 bpx tx 0  )?)/ 0  )?)/^/ 0-L@q d\Q0P0CTq 8O q (Jq E0Z@e@k@s@@ 0-P,@L፫50 K0hIe@@dy 0-L M 0@ Pr4  ( 0 0  (  ,  04 K$0 ,00 dP04 KUgK04b|x /0! / "// -LX@ -LR@ -LpQ`@.  P@x0 DRP `F``p|`@U:80X,0 (Z b@d_>///1/8#81/1/ <  R/ R/ I J0s S40Ho//0H1S0/ b/2x@Q0 Q Q // A@@A 0-@0LP\3/.0`R0DK0h/ 0,,$$#  K0h/@@hG>@@ -LM@ 0 3/(K03/PkQ%0 3/0 P) `T;%.T !7/'!0A`YS$ $  $ $  $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ 0 $ X $ $ $ $ Ȅ $ $ L ܄ $ $ P Ѓ $ $ $ $ $ $  x ԁ  ( 4 P ` d  ̀  Ԁ l   ԅ 0c0C S'd              0x 3/ 0h 3/@ 0X 3/  0@ 3/ 0p 0 3/9 12/0 P 03/0A CRS <00<0 < 0R|3/ 40p 8p40S0`3/00t 0H800,3/0 0x  ( 8 R0 003/70S 7'0S 0L3/d0S03/ @0S00 3/O8OS0 00@3/0S L803/0` h, h$3/@0S 03/| 003/ `q0 V 6R0 X 3/ FR0\3/ `V0|3/0pqRh3/60lLt0|00l0Tf00X0O0L@80q080 )@0SD0s0D0 #0 D00F00?0x;0l70``$7S0P S0D 083/ 0(3/ 03/ 03/0P000000HH 0Rl43/003/0L3/d0S03/03/@0S-/003/ 04`0 6/0\03/\0`0 0 046/`004 02Sp7/ p0A0CS003/0<0 :%&0%0 040 b0 00 0\0 %:00 00 0x0 %40H0 0"l0 4@0 d204L0 ?0 %900+?p0 00?0 00 0 0X0 1 00t0 |2%8 0 00 30T0 TX0 | 0C0 0` 0 ,2Yd 匑 Ÿ h ` ` H ? 8 )P H  % @ `! p # x00 0 %:03#0 0sQ>@A@`@A<)BakA@hG>J}A@@@9@S B@@/ @ZB[B*B@@ @OA&@0@2@(@4@6KB8@>@x@A@H@M@uA AB)B@U,AK}AA@R@V@\@]@b@}@p@@@oAQ>@@ R>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O'- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8 -@0P`P LZ4!0 "8`<` D @ ( H D L  D 0   0wwww 0-@00L Q( 㿊K0h- b 0,’@/?oh2\0S/0S/0h1d1/ 0l/ b 0-$ 00 L@    0 l t  0 -l0LA `pmha,2 4Q0,2<0$!  <0$!V O/Kh bR/L-,刡0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ刡0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-刡0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ ! ($0(000(/ ! ($0(000(/< ! ($0(000(/ b -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480 -LMp@TB 0@ T T0 T9 !TX`` P0 S =S J 5@P0=S PX ԧ 4 < D X 0  SR0U=S@&@ pS@@P(K bS  QP @K&@ KP@ 0-LM0K P@ 0 P RPCH @%K0 -L M@0K sP iQ J5oK0-2P? @P4@54?3P0/x-2`? @A@P(PP`5P6(5?3`x/x-2`? X@A@(0000Kp_KP MKPH0 b/K1 (01 0ᩦP>_/KᢦG8H41$!0R$04$0/bO- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 // p-L M`P@ P@Q0P0sJX03/03/0?00?Kp 0K P 0S 00S0@ S0@P؉bvcvc 0-AL0S! 0S\X l\T0_03/UA 00<000S: #: " ! 3\ #30 00C 30%V:P#:P!U P\ #30 00C 300000C0#000BBΛvcAi!iHb@1?/ //?0 0!0S 0@o/ȉb//0/////?  22//-P/6b N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: NЊbԊb؊b܊b1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N// 0-$0L@4s 0S 4 " 00 000!! 0(0000(0 ! 0(000000(0 ! 0(0000(0 ! l0(00(0\ ! D0(0!0(0, ! 0(00(00(0 b 0-H0L0S0@0  "!$0p03/0 !!0`wcvc03 / 00-@L4 8R< 4 @ 8 L < @  < 0/ 0-P@4 L R40<080@0<0L00" @0200< @  000/ 0L 0 00/1 41H00 001/0</ -0` @ P  L       $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@04p<0002X10700 0\1 -LML1H -KA04pHL2 P2 P凢!@`!.K8QL2` KQH2mK01, K1 17801"H" L"  ?H"eK!.KH H2S 0000p 0 00 `L<`r0@0@2S101(K b@00S/ -LP@`4q& @00S80            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X 101101 0\!  -6LM SSpP`400 46CS(Kt KP00 0 0 0 L0 K0C0C0 ` !` ``@0@20 $Z@@ KP0K!J!<@PK41uZ 0  '@P @0K '040 0 @ K0 4/0Z@42t T  tL0 0C0CL00" 00 0 -@0La0 , !0  P80T V0,H1  ^ 4102$Kk/L00CP b002/\ 0 " WV@-SP*!60 S&PjVA L00L0A>@C`p`C\C  P1  0L000L0 A@P@Ap bP 0b 0-LxM P  p Q `` QQSL0t KAO0 K0 | x0 lP K0 b 0! R!10/wc -LP` l@`0 S   _0  0-P@L!0S<00 00`(P$@@ @|- 0,!605 000`(P$@ @ @h- 0!5,05 000`(P$@ @ @U-0 ,00!t50l5$ 0000`0(P @ @>- 0!$505 000`,(P$@ @ @*-0,04 00'!404 000`(P$@ @-40`,(P$@ @P1 0x40 <@0@0 @, 0!@4@ 00 000`,(P$@@ @,0 0 0!3 0000`0,(P$@@ @,0 0 0!3 0000`0,(P$@@ @,0$0 0 0 0!@3 000`,(P@ @,0$0$0 0 0!2 000`,(P@ @,40 0 0!2$0 00`,(P@ @|,<0 0 0!H2$0 00`,(P@ @f,D0 0 0!1 0000`0,(P$@@ @Q,H0 0 0!1 0000`0,(P$@@ @<,L0 0 0!\1 0000`0,(P$@@ @', 0 00!1'000 00`,(P$@@ @, 0P!00`,00(P0$@ @ @0 +(K^Ab"A @H @T2@ @`wc @ b@@wc@ @@"@*@1@9@F@U@g@w@ -pLMP`K` @L ,0Kd #\0 0p 0`@R0  0 0p  00 0 0c$?oP20S R R (K`wcvc -L|M@KP`p` LP0T rH0D 0 0@ 000000.$ Kb -LxM0`T@pT 0S PK` yLT@ HH0D 0 0P 00000 0$$K-wc -L|MPp`V- @K` OLIb\ FbH0L 0 0@ 00000 0#(Kld 00-p @lLBQQ0PSpvcbbb/ -L M 0K @k P6 0S: 0Ka P8 0SB 0KW P@ 0SD 0KM PB 0SF 0KC PD 0SH 0Kl9 PF 0SJK0KD.P0!0000K" P0KP 0@000KP 0000KP 0800KPX 0800KXP( 070@@tRA@ TA"A@|Xd@!A@@@@ -LM@00S400S0 00 ភ Kucuc00/G- ,0@`(PXP^ Þ L`pa`Xp R: R:pZ6\ pxLP Y p L\!^ppVpW p pG`$` V*Y pp'  ` 0S `  ,PPЍ`V p`P S-LP@` B S6 S 1p1  P@D`F@03/L0 3/W(@`PH PU D03/P0 3/X@Pp`@03/ L0$Kk/R8p@03/L0 pH03/T0Xwc\wcvc - ^L0 P \00C 0Q R>@ - @L`0BPp<^yP 0 0<0P`PD0 $`0 0(,b 0 A<Ky -L MP@(P0,PS`!p!*(KW1X 000 0 PpGP `W U0(0000(0,00(0,0000/ -LM0 @` X0  @2d0(Ko/0,"0 S M4S  0PRy H V@D PpT*0pG>0Wp!80 0 @`FV@D P0T* Y*pCWp! BW0p!0 0 A3A3C?o20 0@`FI0V@D P0T* Y*pCWp! BW0p!08 0 0@`FI(K@vcd_>@=@ -@`L,PK M@%0P p Thf(K0 0S@ ` p[00 0 0 -LM>8  0N@T`p3:Tx3v# 0A:ppPpW 0 6:PL 0p0#1@0 80X1(KP00C<0 <0 00S ` p@0T0;00 倐0 40 04P 00S!>\0> ZJDP P 0S 0 bd_>o@ 0-P. N@L;$0s0 K0h9d_>b0@-ASp`T @TP0 0 0@$ -LM`P0hpU(K @Jd10K0 KGU@110[0  00P`PE -LM`0(0,000pS@ 3:RH0DP DP0P80000P0(`Pp0Kb -L M@( ,  (0Q P080?oU20S R(0(000x1D00(K`V P0A#AR K44 Q Q Q70S 0H0H0 0 BHP0` B0 00 HP0`>0 BB6*100 "*V00zbWp4 00 CZ04 0 0 y P`F$0D0 004 b -LM@Pp00 0(,8`00SP (K?oV20S 100V100 0!0`Fp0P(00000 -L$M Sp`00S:4K 0 dP(4@Y:0 P@ Z 0@@ <0 8 Yʅ\8<0 P%d.ʌ P @R Yd(K 0 -LM@`T4@  0S  0000  0 0 00000 0xP P@0S(KP pucucA-P`@PpU\\0.b Q   \ *8  00GS0!>000P-// -LM)0pS@P`  ( "%+PPV@P@VP @ؐK*0 VPV0P0" 00"%Xǐ( +0"%VPVP PR>@@@ -LMPlA2/ R?0r? 0AQ,CQ B& R  C4 0 >0?`0?0?0? 0?p01?0/00/,/(0 00x0 0000  000L0  8Khxcxc@xcDxcHxc xc0xc@@(@5@n@@ -LMpPQ`[U֏ KP0 02@Ÿ0 *R"@  t"KsL1SܘP 0SKDƘ> Ci (K k KKA KKT:T\1YT\\1؏\1@ӏ\1  Ώ̏1!0S 1*B0S 1VPUx1 R0S XP1 R0S  0T| 0AD@T& ! Vr0@ Tm0 KKߎK冏|\1 0 |H@boAR>AA@J}AB@@V@c@o@u@{@@AXV,wcdwck@@S>@LA @@$@1@=@J@@@ -LMpZ`ZPP03/xB0\L3/0T1`2PXHq0 08@e42 0z0e2 00e2 00e1 00e1 00e1 00}e1 00ve1 00oet1 00he\1 00aeD1 00Ze,1 00Se1 00Le0 00Ee0 00>e0 007e0 000e0  00(es$Kkd`$Kk蝎vc b@$@1@@@]@z@@@@@@$@:@P@a@r@@@@@@ P-`@ P4 p!apЗ!$ 4 R LpL AG 4/!\@P!W d dP! !oDЍ bᜋReset vector called, LR = 0x%08x-DMO-pB P!W d dP! !oDЍN  0O   ! "`"Рo@@@ @+@S@{@@@@@@@@@ -LM @`Pp 0S P 00PAP 00(PU尉(Q 00(0L0$K@0?  0 L0 00S  0 bt A  P$`@ p-L MP \`@ Ht A 00 `$PKp p-LM41@x`QP R& $ ?0     P!Q0t0K$0`0E40(L0?0880L007Kphb A=A^AAA -LMtT@0a3/03/-  0P 0S  !00S0 H1  ᫽00z 0  QU 0K0 05/P:Z 0S L0 t߈P0 0~pS( w W$*430S (0S L00R6BS 300 00St KA 00 00 0夠 儀 0 K>41D00 :S L0L - 0S0 `201:+*B*R8 ?+> Q R3 < SPP 0  0P0 0(l1S#Z07t0S00&R ! R &R ! R QP1UPPP0 (0d+0P(0S 4k R Z 0(0L0(K0 03t K0 t@ 0 S S S 0 0 4QxpP_P0 A0 p 00 0儀 0 [ 00 00 0vc bt^>AvcbA&AEA -LM`1 @PMpQpWH1  ቼ00S  !WL@倁$ 0 0t K@00 00 0 K0 @ @ Q0 A 1@T=L@0* R8 6 @0TT00S 41~pD 0 P 0 *pP t K?0 W0 04qxPp0 0 4~ 00 00(K bvcEA -LMX1XQ8 d0@3/`q@@aW<8ʀ 0! `! 0   , !Z Z& Z.0K|00P0S00[0 0!!`q0   , !(K0Kr00P0S3[00Ky00P0S000 Çvc b$cDcHc_>sA N40-SL@00M03/000vc(0P$0141D00Co/b b!:!P/ 000 S/@0. T4S/Q0 /0b - L ? - L?T -0ycbvcP/0S0 0 /000/vcQLQP0\0 /MQ/R0 S 0@0D0/S/0H0vc Q0-L@ L4S080MX03/000M4S00<03/0M40vc@-0S ^@T <$ B<$ X ^ !! B B!!   B B  0b -`L MP 0@$PQS S`UQ0 J RK T10(Ko/ p \\ S@` ^ 0^``h1 U VU4 # 0` p`0 000 .4 'W RL 00  >0 N+  @SḠ((K `" pU 00W00S` 4 )1 4 L N40 40h@Tbvcyc -@ `PpLVQ 0 "PP 0`@R  UPp`U 01P41D0 b7c 0-0L@ C(0"(  P R0 H4Ph$1P420P!%R @A!800CS00 80K0hb@yc@{c7c -LP`O@<l@[@[PP00D3/003/03/D0@$0 0ycvc -pLMP(Ko``` `XࠟPU Y@ Q0,03/0(Ko/Y@00284 (0C84 0<40C<4 0`01 [[ [yRH}cvc -L$MP0 `00 0Vs  000 0p P60`*6080 8 0<0 1D0 <000040 00 0H0 I 00`0@0 9 S@ 1 @ 0@`0 0@0@ 0W1 00C0C1 0100010240S ` H0S 0 @Y 0< 81N  D  4 0    @40S @(Kycb 0-L@|0T0HD 0S0\} 0SHK0h<0Q<%   <% @@b@-@\ QR  SA  B      00 0. <$  B<$ 8 0Q!SA  B!!b/ -L4Mp6@0H0 P6`@5S80  M8 8000VP0 0S40 4000  @u0 0L0 0Y 6T=0P<0 %60@0 <0@ 0D0 1T0 D0Z  P8 M40S 804 S<`q0400 p L 0pR    0p %D 8 P0P00S 0p ?M4S ` L0?o2*2 4H03/m`tH0ST Z  Z. 0D @1 NTMT 041STH0S  H4<%$ P4200P180S 80 <3V4 v`/%%: 8p<0 W l}pP 8p%:  000<0 0QM  $@0 |P @0R8  }0   `00SO vK %* )PL0 1 0T0 T 0 TN pz(Kb bH}c -@L M@P p ` KKpP`<` (60!0 \04 00  㬠!@ 2/0 2/03/40  h00 05WY 0D<0(Ko1\ U 0 UD5 0(Kbvcyc 0-LM0@0PSKIPK00  0KP J 40 U0*07(=d@ -L MQ`@|4P T:4000(Ko/$::6V0100 Rp$U?P唠P00S0בCǑJP @0  <@0 } 000@03/003/JPbvcyc -P@Lp`2H$$:$  Rk(DF0@00W@V UPPP$, !R ,# RJ$60DX 0S(H$H J$J@L b0 0-@`$ 000L 00SpP@5S d0)H4$V7 DP4VH5HE000<50@@K0hOA -LMP@p`(Koe0G00 00<0 T :00 S:0 SJ\(Ko$::6W0140 lP4@ $e?``408` T*+ ) 0 yI 8 R <I<0  00T S  NFJ O4S 0,03/0O4(K?vc -L M^PPE@p+또ZT:(Koe `fW`1P@ $5?0C@0T*  GQ8 !00 2/00@Zvc 0-@L0>00' 7X<Hu8ujt1q0p H4!*$01007P4 20040@,1 0$1@@0 @0@@r1 00 @@005k0 00@@0 @0@@r+000@@0 @0@@r <0(Ko/byc b7c7cEAqAAAvcAcTxc@7c8~cvc!6AT~c`b=AH}c!CA@{c!LA@yc7c 0-LPHR4@ PPR @ p0@50cyc -L$M0 t((t$1P`@@s(0@@`(0㓆"V8 :(K0 "PP2y0 0040K0009   OPp4pW U: 8`C80 ~Z p@yc@{clbbTAucuckA@0!S(00 S000+  !/yc -L0`St0@!* P S\0PP0SDKP(x$EOKhycAA 0-@ !:L 0T$ TD0b ->L0 M~0PP@ p00 `xR R `<1A,A 0-@!:L  0NK0hb0 /c 0-P@D0LM@ 0SK0     fcC-p0;S AP@ 0R0`VP B@`p WV*c-T0+RA 0S00CQ ^ c  -AQ`++D%L 0L+;;0; `k`& ;/0S0P`k `+ +++ 0++|+t+ p+ Ul+ h+, xd+$ `+0?00?cyc !iT !|! -`P0匀L0pB@N@N@TO0?0000?%:P,{w%5?[WZJD؊b܊bPA -LM@ᜀzT:00(Ko/$::6WhP!P1$e?``T*L0 HS @03/003/ $Jvcb0H4 /b0  ")//0 !Р!/0 ! !/ p-LMPFP$ OK,`.02 ~?2 02 0  \ 1 Q   ,0(&#(0 <@0?6/Kp6cʈucb4002?0/S 0?0 S/uc 0P/uc 0-l0 0QPL0HP0 P8@ 0ASA00006cb -LMH2HR<03/0 QP (B0S0"S  & Pu(Kopu*FPi 0Sf HPuu(KouXP>0p P?#Kl1l080 `a0SX=@1a<0 <0 C06SPp1D u 080x:0800#K8/P#K 0#KJQ Q Q uQ Qx|upzuhd`(Kvc6cbA@KLAAA(cuc3A Bd_>A(AA@AAA p-L MP `0R1G!G!H!H! $K @P$41$ D0 +@|0d03/@`40P@0  $K@P <0$ 00400040Kp@vcb/? - -p`LP&.-~M0@:0@P -0U P00PA;dbd_> p-L M0PtMu0@l0`@@D@T0 0 0 g40 L0000L0KpFAd_>b -0RL$M8 <0 P P818q0@0 00K4 K@?P? 4 0S0 S8%jDFjFd 0H D0 1/1/X1!H D0HE@YS00P S40 003/03/X80<83/ 0Jn$JQ`Jd#t(Kd_>vcPA 0-$@L 3$x0008c 0!&-`L@ J\P@(@`$002PKh^8c -`LpP0@T tt R0@ R 0Ht x0$09%6P Kh\8cAsA -LP>xT0`V VxVEP `$ 0S 0ES:`8c0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/ -LP`p@P @ 0 +0PT`\00XpD0 0L00h000[ 0@0▷00S/ꔏbA 0-L@P P00K0h/ᔏb 0-L@P 0 R00K0h/ᔏb 0-Le@P 000T0X0\0`0d0h0l0p00Pt|x0! z0A 0-@LQzK0h^ -LMP`@40 0P00 Y*(K00 S+ 0R'p0' 1P 8 %'8 p 1P< '< 8 1P80 p0RP040@ -LP?S! -P@L`00S0Kh-800800w -P@0L`03/0S800800qw -@`L4o0, ,p2PPE0FUoꕽAh_> A -@`L@00S(lPP U2 U U$ 00 03/lwo6Sn0m|48olohjoppU" qU %U P3/pP8008080@[ P80 P00 03/nDo6So npp W~P`!P`!`!b!b!`! a!<`!x`!b!b!a!x`!b!P80 D \ `R0A?o20S0`0WP 8008080@x :RP P  80  x %Ry R P Px0)Sy0SP80080808  PD103/Pw00 03/11n6S%pG W'Hb!`b!`b!Hb!Hb!Hb!b!`b!`b! b!D0S0CD0PPP n D0S nP0 xns0SHn> XTnP`s0S0tn A A@ Abh_>J}A A A A A A A -L M4 * 0 ( 00 K0 1K K' 0-`L Mpp,` ,0K$0㈀JbK(0KP0@ ` ,KP0 S @@-P J0@(0K `0 ,K $K'_> -L M40: 1KK $ 00 K0 K K 0-L M0 K<1K K (   00 K K'` -L@$MK K K*   KK  @KKK -L,MPp .K@`%&Z000K$4)0K0 00 @0 0* 0 00K/K.pK(@Kp K -L MKK0 0K 0 KKKV K -L(MPp` &K@%U0(0K$4!0K0@ :00 0 0(K00'pK @K003K 0-@PLP 0P00 -L4M4@D5,00C1  קpP+ 6K%1 @@3K060K@000K>0?09 08K0PP 㶧0@QUZP˧ɧ(K E P!0  ` P @0 Y @0PE`\@ -@Lp0`;P0P0vtPP P0mt0p0`t0u0_ -PL@4p`WT0T$ :TR 0$KkH@t`@H cP 0 S08 @TW00S 3/8 0  S   8 d   @@@ /P 0Sd``0VQ :Q|@T.u\0Td0S`@ -L,M@@Pp0❰d0Sk0Sh80 00 03/xhl0ɰ`0\SAH[lD40X3/`G0ⷰ@` 80;8080崃K008:0?4 K0 l0 8K8 8K80P;80夀 Pd P0 d00 03/ h!l0d080` 0=d0S `0u(K0md R񟗔m!m!m!o!m!n!n!m!n!$n!003/`0v0d00<00<0H00H0P`{0@00 03/,kd0S0(S@080 D040 0 R0C B0 00 00S00 03/k000 8 K`D0S` 0CD00ʯ80P0 0`!00 T?0|`PL0 $!0L00bD @,P``D0S0CD000 03/mk00 03/ddkd0S 00 0S 3/0u80p m8 A] Ab A A A|b Adu! A A -L MqP@`\P d00C?o2?6\0S3v`` V,`0S)0AU0~(Kd0SpP P 000 0j00 'P0p W | -PLl Pd P\ PT P  0< 1`0000q h_>P P P P P >/0( 1d/0000h_> P-L P P P P (0<w 00 01d0000ꀖh_>00/00/ -@rL0⣮x0S 0$Kkݮ|`V @ 0R L0S80   80`3P&P  P0⼮ 0s P80 @00 03/@jx00x0t00t0r R00 8080;80 0@T PeP_o Pu0ST PE%T R0U0 0 03/  jP0000k v}K A" A -@L`4PU0x00S0CUx00Px0SKh[ 0-@PL|00P 03K0hAt  t er0K0h% -@@`LP0ڭ<0 0HP0 T0 00T00 0@ 00C080 @080 1T;80"T <0d 80<0000R 0L 0L0d0S0S80@;8080 @0 0Khԭd0S0έKh00000@@q -L ML@@QP P0S P1XRQL 003/<0\0<00`d0080@80   " 880000080080p08S  0808000 `P6 0Z 0 0"3/t7880808S S S 0"0!00 0 03/8hi3/hH0IY0 0@P000p (KZ 0 0 03/th@00p<0 03p p`0Ӭ[& A A A A A -0L@S 3/`Q`a0⾬P00P0pt0WS0Rp 0t003/ 0t00 vt0 F0 0⋬ 0t00Ŭ W R00 0⵬pp0⬬<|b A -@PpLM4 0@ ,@ (@ `0S K `P@ 004 K00 X q- ^ /$0/ -`LP4P@$@T @P P 0-L@9P0$0S0K0h 0-<@LP @TF00U @c p-LM@Pg $1P^ 00 03/g$00%PU !R00 03/g`` @P:0`: 99000000@PKph A$ AO A 姫c -P@`Lh0K10@J1d0S7 !l!!!!!!!\0` 0C18000⋫00Khū lI!F0K1plIq FKq00 03/<Gg00000 03/d9g_ A A -LM#K(U` "S S SS Q:$Ky.A -LM@p!<0 P`7)( ):0qF 0 2$  0 c10S d (0K0 0p*$0$0L P1RpYq20 c90d0$K!#30 9(0 8  `\ Q  C40l0@0d 40 0 d0Q 0 Xc0 l d@c9bFAJcuA|bAMb!AA 0-LP8@9K0hc -L,M\0h0@ @`%0 p P< 8 0<0 H D 1H D 0 Mcq9<00S 1< 0  =ctc 0 0S]90d0t0S 3/_0@ $ \20 8/Y0 KL0  0KpY ``29(K1 0   b0d0 9x0S 3/}?@0 ,03/ ,0 3/ ,03/00 8   C$  0 b Y vp!!!p!!!!!L!!!80P`0 lb<@T0 4/80 00 08`800 b0HQ(0 b 儐0 <9/(Y0000C0 ` :/I800 tub0HQ(0 Xmb `0 <6/(Q800 Wb00`0C@00S@0  dH] ,03/ ,0,3/0 J 8b0 ` 80B$ 0dl  X*bP80&b#A<AfAAAAAALAZAAAA -L4M\ ph0$< @0 0 `@<0D H0 801080 30 0D H008  a80Sg80 0  4 0\P 85/t0S 3/@0< $_0 \P20 5/d0S9 06 00K0800 0PPH0D 0 00 00P0P@00K080 0?PP00 0S60 0 <a0S00ʅ0040\P 85/ {\801LPU,#㠡, #à0! Gt0S 3/@0< $_0 \P20 5/ 00K0800 0p P! 0 -0pL@PD.W`@0Lp@00 .0 i_.P0 0 .@P0d0$Kk80帀 00 0 00 0X00\0 P080h00$0P 0.$KkꤏbA_> -@LP0H`   p x 0 t 4   ,  , \ P eP0 H00 Pp000000 0 D؞!!!`>0!A -LP-@-`-P0 }Pq 0KhL -L`P-p@吀l0S 0PPᒨfff4 P00 `|bA 0-P,@L P@Ȣ kf0cA p-LM`@f-0P IPa`@/-+a`0!S\Q laP08 X0 S,`>A 6D!O B 0-L@*K0h -`LPP0@  z_0 0 ?p@0V cxu `- 0XR00 d4dᄖp0lA|bAccc - @LP 0T T T T `0T 41 00KhKh<0Kh} D3cUUU R0@o/ -Lps*@P0ɟ\0S *`P 0S P0Kh -LP`P* @0@PP>=c;c9c4 P0⍟ r @ R A/ 0-QLM@ L^P0 0@U,@ @^K0J}A`AVAA -L@P*@P`)0d00`0]\s^4P P 0;pbbbpp10 ᾤPd ^@\pPPW$Kk803/P@AAAA@ Q-L 1^A -LM`(0KPp0 0P40t 40d0@P ,L0 X K^)Z ^l>Aln> -05 L(M0  K$ 00 K0 1K K0u 0-L(DA@0 PQ.80080H#0 0-L(M0  K!$0  K*K[ $ 00 K1KK K -PL`(P@000S4 S  pNi j.\i. }!U0DQ0000P 0X00080 080m\T]0 xP4Kh\H0 S@10@1bA@n>@ 0-@@0LPt(hQ0P` U $  K0hi 0-L@b(P@0~i0K0h谝wi -l0L@0p0CS@PRn00SLx0SIypWF|`Pq1 0Bn00Sx0Sy0S|`PW0 0'n00Sx0Sy0S|@P<00( 0 |bdu! -`@Pp@0M 00L(00 0hK3c -@` F0LM@PhpP D18 Q9@A XT00 0l K3c 0-\0(L@!60DD@1 (0$ 4cR$0D1K0h:3c -T@L`0PS 0S 000 0X000S 0S000 0I000(0S0S00 0S0000S$00Kh -LMPp rK$ d6rK7Kl K@H6Hf0 `P0K tKP0 F0h h0K0㰆K`0K0P0 0KhKd Pu'["(X  ᳒  ZK%5P%K Z K 0V K@ 0 \KT@KPR $"@%(X7GȀ5刀P($U K0 0 \KTKP6c0 0 0 @ ☠ 唠 匠 @NT*  \ R@P  @ R 0^R@@   0 ,$ 0    g (K @R `R RPPVPU ! .bRVPRR <PR`RRVKPRPE^.P`X0 `XEP XPP T @T  X  C \ \ K 2X PV K00@ \KᴥKT@K3P5 !$$("Y7*t2",U K0P0 \KTKP  P `0 @0 0ሠ  IRʌ R 0`PB+   P q0 0 \`SP@PE\ \@ x[J[!$$("( R㰣K0[N [$ /[M [$K[     !"      @ I[ @   P,,,+ HKWDKT @KQ<KN8KK4KHV;T8 -L(0M 0 0  g KX!P! -00ML06 0 0U KX!P! -L(M KG0K0K0K0 0K 0 K 0K0K 0K2 K0u 0-K L(M1KK0  K( 0 00 K0  K0u S0-L,M@K  !K 0K:0(0 K00 0 K0u 0-LM0 0 9K0 0 01@0% 0 K0*0 0p0K K`PPQKK41Q0 QS  QY;00Q 0  K" ࠟ8K0 K 0t0K KpP#i [n0[4~K 0 I0 ~K(KM$0x0K pP0K KypKPHKF8KCcP@0cS 00(K0u!A R -LP`p@P 3P0 ""H0cH0$ 06000000 0 0T0000@й! -L$MPm$DA0™ 0R80 0804^#@c@` $Hp@|a 0KdKWV6+^(4%S 00p@0KL0K@`K#8?0KL00KL0[=0K $0 0L0 ,@P0 U0,S*0(08 4 KL6K80K"410K0 K p8`Kꔀ  L0PTp\00D0@0XhPL0@0␙(K  |b!0u -SLMX 000 b K0 0 = N -LM@l4  P000 K P000 N -L(MQO@Kp`P0< KP 0< KP@0S[9 [8K!$$4K("( p ` P <K $K p-PL,MQO8`K0`P4 KP `04 KP80S"[10[0 K"44, K8#80  Q   4K80 [Kp -L(MQ K@ KB0K,4K0K0K K(( K@0 K K 0u -L(M  C KQ,$ K KK K* K@ K K0u p-L M@@0 P Da 0P40   H0b",4b4#04!400 S0S000Kp 0-LM@" PhK?4X0/KK!0X00P<3 <000 < 0 K0a!A p-L M0@ CRP`0 0Q0|P0S D140; Kp0 `0C0S 0C   D!4  a(!"$a$" $!$ -O F0@LMpp`HD9@18@P@@$S@@T @(K$/V }?V| @0CVj *0CVX >V 0@ 00 00&eP@0@ 00 0 0,@>VA 0V00 w@X>V<00<0 >:0Vr 0VQ@>VS 0CV8 g:0V: 0V  @P@1 0@1=V1 A:U?0V =V 05nK0 0Q@PD140   4"4 0 z<-V +0-V $=Va 1v8V@ C ] t 6 *=KC C @F0@@ -3K0  3K @ 0 3K PP@3#0 $"448#8RS00H,09ӑ0;0040 z 3,0@=KC C {@F03K %43KSK偃K :0< @0 3K J@P0@S3 33SVt;Xʰ0 S@00, @ 00  @0@ 00+ PQ0K|S pPP|3K"0*t3K P5>K @P @T : 07>K` x:7.K7K00*n3K 0 h3K P0 @P0 7K00C30 30 3: @0p0nCKiCKhsK@P030 00C3ᦌ9V 0V0 0@~t)V*  BV R@X 3 @nP  T @g@  @P `9V 8Vp;@PW0 Q3@J8VP 7C0CV' ]g17VS0S@9<@ 5K 8@ 000:0 5>K@P&20G3KF3[0F3K 0 CR@ P ER@p0S 7nK 0@P 0\3ls[kS[0D#[UE3[   D#KD#K  @#K 000O  F#[E3K@ F#K75.K000: 0<0@7V 3C7CV`0F,S@5~K0 Q`p@P0#$$("( R !C@6Vw 6VC 3C7CV  @X6V N60V0S!!!H!!@P`V pW@0Q_@0 5>K@PN#[M3[@0C100 5>K@P|N[WJM3[`,K0S``P,0K3Q#QQPPK@bC@P_E05nKPC LC @P3K6"4I3K4H#K@00 @0@0 D~@E0\ 0 QO@95nK @P30 0CS 1K⬯@)5nK @P#0 K0CS 1P 0S 5Kk@pQ_5nK7Kp0 P 0 @Pp3@S M3[/K"44/K8#80   00pQ_7nKߏKp0 iP> 0 a@PN05~K00 V@P|3S* !$$K("( K!       @m#[KK M[ @0?@0 08@ @01@ @0*@xQ|@s  @m @g  @a @\  @V  @P  @H<0@0<0C; 00  0 0  m@43c c@c Q c c c c c@c ccLn> Ccqdvdcdcc<cc(@ 0u*"o!A NY0PC P3K0LC HC L3K0 H3KX0@ @00@05K0 /@7>K  5K0 S>4!! !!0!!!|!0!!!!* [0 p3K0  g3K 0 5>K7K @P0I#[0"30[0p3K0 030f3K:00 0x1g#K7K00 5>K @P K[0p3K0 030f3K:00 017K 00 5>Kg#K@P K[0p3K7>Ke0 030f3K:00 0l2g#K7K00 5>KD@Pp L3[ # #1 00 05>K^[0p3K0 030f3K:00 03g#K7K00 5>K @PF0I#[0 10?\0p3K0@030f3K0 KgCKO3Ke:00 03@ 007K0 5>KY@P00\0p3K0P030 @f3K 0 KgCKO3KC:00 004@ 007K0 5>K7@P0P0[0p3K0 03?0f3K00 047K 000005>K@* [0 $p3K0  g3Kf3K 0 5>K7K @PL#[00"320K3[0J3[0 f#KO#K \0L#K* t%p3K0  g3K 0 5>K7K @@T@7>K x 5KtR0p3K0 j3K:00 06@7K00 05>KgCK@PPoKT X0V00VP0E0V00E0V0E^ [X0U 0`30E Uf5>K 7R 0P#K p3 l3 06I#KJK 00G#K 7>K 5K @Pl3[0k3[0DPw8`P@= 5NK R0P3K0I3K7 00p3F3K:00 07000D0X@P+P1@7>K 5^K R0p3K0i3K?0g3K:00 0L8@ 007K0 00@P0#$$("( 0BS @Kx݇`P@ 5NK R0P3K0I3K8 0:00 09p000D0@P  04#$$("( R @χ9.K0 @P~ Ƈ0@ 4@#ĠČ0 Ƞ,Ƞ3 L, (^`!!!!!!!!!!!!!!!!!!D!L!T!!!!\!!!d!x! !!!!!!!!!!!!!(^p!!!!!!!!!!!!!!!!!!D!L!T!!!!\!!!d!x! !!!!!!!!!!!! pt'.^ T< 3 U P0+ pt'.^" T kp`p 0  +@   (l,l  ,! S T@B|<7KpS 0C0PPp3K0j3K: P0p?K hsK@P,#[[00C8#833## N[IS[G#[00!10000L3[F[43K3[M#[43E[J3[# b4303  K000@' 7c[8[p1c[<6[4c[t5s[ &`3c[p&2c[&<40 00 00003[(0000P0ESU @jQ 0ES񟗸K  @PE3[U`?0E3K=#=E3K00:5.K0<0 @P U   h@U  @Q Q Q@HA @AQ QQ +QQ9A @0 A @0X 5KP3 00P#K 00"K#K* h LK    @@6K@ 0E3K5>K@@@0u!A -LM2(@!60 D1`80pp$0p0H0((0 S  jPP p #AK ⪤ 0$/K?P00 0J僤T  ~p{ ȁ 4! -L,M$Da@0 CpP(|R*V P9PQ0U S   @1 0@1Pp P pW}-P Upt(K80&;DH0 Dp 40 $ H0 S+D0H 0L14H!;P1800 080 PL1 0H1$ (0d0,0000 80p080D KHKP ;H10L1@0KQ_00< KP@0S[9 [8K!$$4K("(R  $(  RpI  <KP;DH0 40 D KHKdP !A!A0 8< 0/ -LM@hD1pP00  0EP54  `8 )@A0I 4 `0 8VNY0┍00эkc/AX7 (K!\o> -L(M DH0S40<@0 @@5  K, 00 K0 1K K꠆ -LDAP0`@1  P@1`0 X&L@1@0@1B80 .800806b"A 0-L@1@  P@1`0 K@1@0@10b"A0|Xd 0-L@Pf X14D180X00X00 0-@0@LP@!h@` @!Q0P` U $  K0hY 0-L@P@0X0K0hԌX -@PL@p8 P00Sn00Sx0$Sy0S80 00 03/dH80<80`- l00p0CSn00SFx0SCy`V|ppHPm0 0>`n00Sx01Sy0SO`VPH0r800800⮌9(!`P` HDK0_800800⛌`"A"A|bdu!"A"A -`@Pp@0M 00L(00 0WK2c -@p F`0LM@PP P D180 0S9@A VT0`0 0 [$K2c 0-p0(L@!60XX~@1 D1800S (0$ 4cR$0D1K0h12c -LMp`'PQ@Nş 4%< ?\$ F V Z8P0@K0 KK00$K -0(L@!60pp(DaP80 80000$00Kh"P KhW2c -L4Mp@ <K%0 <0K幁`P P 0㈡J @ 0 @0 <KPP ὁ (Kp {x :Kg03K 0 /0K@0 ^@0<K@0 P0 PZ@ <@@P0@4@P0,(4@P((8@$(<@P N -LM0K0 0  Ko> `0- 6`0LL@@pPP xP  0KhmW2c -P0p 60|LM`l@OP KTP D180 0@ 00 00W2c -L(0M 0 0  $ Kh!! -00ML06 0 0 Kh!!  Q0-L@  Q  Q P000 03/0d0?o <0cT4< (FF0 Q  Q0"A"A#A 0-LMP 4  \d @@  000 8K0@@   000 p -LHM@`pTPK0 NX0K0 000W0 0(0QP Vp$K`X0S$[Q0["4408#80S0?0S00?o 2 Ă,$ $("( \0R0S0 $"448#8S>0 -0D, F0@LLM p[Da)018 P@@$S@@T@,W4 3WD B27WH 0 00 0 0DWP@0 00 0 0JP3Wq 0W 0CW@(K 0@ RX  P  T @ @P80 ,H0S0 \K 0Q_`K00\ K@P`0ST0KX0K0Y [pZ [ppS40xx0 \Ki 00H00\ K0P`0ST0KX0K0||p0V H0S=0 \K`G`0K0@0\ KQ@P`PTKXK 00000000So 0P ?000&   K 0\ KD$d  \K0\ KD[-@P0 @1 @TG b@1@P@0`0@1>@< @:2cpdpd udp -LM0@`iP* D(08P 8 K$,6 K$(4P 5 K3@K$$@4 K&$1 K @0 SK0`K @08  D p L 8pKT 0 -L`M1PS@< 0D`K 00K$K|4 00000DT0KP` PM0[L [$"448#8 0 DP< 0@00 0J[0l0h  tlG[5: `K[I[0 0(p 8`H[ <$0fK SRWVQ! 8B&K! ap'$+4"0  > "T1j/(0P1 ,0H100L140dKDS`p0a]0# `0 X0 \0 T0 P0 L0 0l2` K 00 `KT0KDX KAOPC PeQ0[Sb L0[0S: S\ PKp`0aU J0[K [48I [0d0 dDP<d0 d&&Kh  '#h0 l0$h0+4"1S=xeBD00(0SM@00 000 5:0>0"dP0 TK`0K0 000T K QP`0S$[Q0[P K"44L K8#8S0 48D1 80 PR  PL ~PH   3/P p7#A N`#A -L M`p@0P 01j 1S409400000Sg S  `AQ!]OQv p 0DQl0h100P 0X00080 080`D0E40 -PP RhPDU. U/ UT`d^!0# (K_ ! T1(K0P10H1L!DlD\l0 h8PXDKH0 S@10@1,D$`b@p>oA|#A!!@#A#A -LP,DA`0pKP<1)6 0)01 S R P Q PP  P X808PP RP80080 Y. .P 80080. p-LdM`P%CH10,00@20!40L10H3/P CP 3 *0S tCPH1KpS] 3< R00pK0p K C#A@@0u#A$Ap>9$A -L Mp@ 0 mP`+0 9 `4 QPQ0Y 01`0 4+V]PL1H 03/?00 00h?00 00`?00 00X~Z ^=OOldV (0l4$F0H!0H!0 (K0"(p>Hp> -H1P`L l0Rd PPF@VPB@@HHpHV4 !8@@T $Kk0@xp>P$AV$AoAAakAA -L M@2PpW H1(KoT`D00LY uP""|"""D""" *0 00000 R!??W 0S@00L0S03d00!C (KoAt 0  0pH1H*0sH1 p P0S  p3 d00pC0 00 2@0S *"*?0S 0S$00H1B ᲃh4 0Ch4O(KonO긐b$A@$A@p!"i$Av$A%A%A$A !"|b$A -pLPW`@  8 $"$D00H0 0W#T`00 02P3  (0h#R 000PP202d4S H10  W0 202 0< 0e4S H10  0S2<2P3@20202P3 0<2P30 0 2022<20Sh4H0h4L103/PPP ?$A$A 0-]@Lp#RK0hJd0p3Tk 0-]@L#RK0h6d03TW -L`p 뜁@?^Y00H1H*0[H1H1p 3 "<30"02P  0h#`0R02ձ02ű@2 02(08HL14$03/P P P +?)?<Qp#"P#"@#"H#"(#"`m>\k> PLHc> 400踐bG%A%A %Af%A@%A%A%A%A 0-@L0  6> C"l3l$(0W?0,0U?000P3@>040K0h  -@`pP@0M 600L( @  0NK2c 0-L @ P0K0hM `0- 6`0LL@@PP P  0KhN2c -LtM 1@3`(K*>0 P3` plc 0P 00K ` 00@0 0XhK0PCX1UPH1`W  %&&&GE`lpP,08(0<`4 LHp 7/P @ %`H! / V %# * R` cm #R K (  K f@@@0u%Ap>%A -L(0M 0 0   K(",," -00ML06 0 0 K(",," 0-T(0P@P#0L8P3 @l3$0S$ K0h2c -LMp` P @ ş 4%< ?\$ F V Z8P0@K0 KK00$K(p> P-L@<00$001H1{ 0P$P l<`1H1x V`Kh05SN4S*%SF$S* SP1lQzPx0Su 030 30303:303:33030400,0? $0<4 ?"0202<120080$0<01L!H 2/P 01)S 0SS S*9S :`0CSS Sc- c  01*01`3l01 0!`z ,00*0020 00#0-000 0#4?`f%A9&A@@ 0-x0(L@!60``P3P P K0hTL00$00K0hJ2c -`@Pp@0M 00L(00 0KK2c -@p F`0LM@PP P 6> C0 P3A> S9@A VT0`0 0 dO$K2c -Lp} @mH1PH1h4 P !S*E Pd0P_POP0@ h#P|b$"R/00S  0 r 0@o/// p-LdMH!`0PS }?!60#Q0P# ?0 ; S00,0,00YZ2X0%XS40L1@0H3/P =>PH1 Kp3 *0SP S]P3<P3 38 R00pK0Dp K>@@j&Ap>&A 0-L P3@  L1H03/P3;P30 0-LP L1@0H3/P000 0-L L1@0H3/P kL1H03/0 -LMPt0@ `Rp P0L&60DaP 0@ 00 00KK踐b2c -`L1H LP0p3/P@ T0 T,L1 0H3/L1 0H3/P@H10S( T6:@00;00E0@0 0FFH1 ;@&A&A -LMpP `@ @Qm~ 0hdL10H1 H1d% H1  pcc0<(~=PD 2= p`I$I H1  %U4 P= pF^0K0,(p$  `0P 0($(<(Kk?ap0 0K  \` `9" l+=̓ 0QD!R ? `#K K=D1 <0 H16nQ  H1TU <?0W P3<P3>0 P3@0P3P3 _ ;"> C F1h3?0 : S<?/0 80l3l!0#` KDP3@ 0F?D F!l3 KT000000<l#&A'A'Ak'A'A'A(A&A'A'AZ(Ab(A(A(A 0-LL1@0H3/PPP3P D;L1HP03/0aP30P3P3;P3&A -L&MOKp`PPP**0B8#8S6 4 Q0H160,00R4003002L1@0H3/P x~;PH1%K3  3@ R00'K0'.K$g;-P0u(Ap>(A p-LM_K@`P *p0B8#8S 00Kp:@ <000d$RH!     8 -LMS @ 0`l00 pP# P#Z 00 !BZ !Z 0 p@ 0I`a#Za "Z  4  P<0 0 S   SȠ*0S}  <p0 00000 00-0 :60200:60 0^}`oWP  ᛖ`(KT ,@7 X00X00`$H@R H!!0S`$80⚐ ,"q "~T!`0H1A>(Ko(Ko(Ko 000041pD0000` 080,0441P0``` `2cvdndQ("T)"K  0- @0L0 2022 00 000H00D000h020p> -L`@PP0D02, 02<05 2/Kh0,0 0  0,0/ 0A,00/ 0@00/ -LM<0`!P6)@p 0S j  0 6n7 0 0S0L0 [(0K0 0X0'<0PX ` $K<   0  6x0S 3/( P 2  (0 0 y6 p@0 7/c 0"#0@ 0C S 0ڰ2= 0*AF*Ab*A*A 0-@PLD1 K0hf -LDM@P(h080 0<0< p@0 0U 0S 0 0   \0 80`p +48\0 09*h003/! h00 -LPaL@T 0  <:,Ko p| 0S0 009(0S     0R<0W:"0S0C0     S0!QW LLY2P \0S 3/P0\ 0000 0  0;; 00X0S000 1,\ , ` , @,0?P   0    RP P W 0Rv~( \ R( ,` (@` q>+A 0Q$c -@LPak 0B 0<@0 09Kha0`0S 3/Y 0 Kh&c -PLp$`PpD  \,@Y0S00,0!=2?408@<003/Pp 33@ 0#S 1RR00R0S40\ pS p^0,0;200R80 0K0C?o20$ $ S0&\, R 4 40$ $ cNEFXPi'TD -`LpPE$@PP 0,00202?SḒ40003/PP3 PP2c -@LP 0<X01X 0@1 00S` Khi10X0S1X  1@ 0 0 0<8 0 0 01 R0S 0=@SfKh -`QL@X0pS$P 0\ ; 0`0R`0,0`0\ 0 ?Q00100000C0^ 0 H8Kh/ -PL`p&p0<00@ @ h0 03/<0@0 7  -@`帀LB,A 0-L@ 1 0S080S0,} T- @L<Pr4!pT` $1T 2C7CT07 T9 0T 2C7CT00,Q<0 R# 4S @t Tpp@hPW<00PA@P -$4c2A4A -LP 0` S @ <0S@ 3/@P 00C 0 -LM`@P`10@P50S l pPCo[r000rYx0 0`h0 _ P T#10H HwP4$Kk1$K@bP"БcJ}Adg"W,A,A,A 80- L$g@0000$4c -LMP@儐儠80S(K<0` 40 R P :0 7 400 0 0 0..@,A@ -AMLMBKP H @pMP00S000/K<,KWPw 0000T"S006SD B `02#[R& 0$ d Vfd R 4$ |  84 P84TY  .1d R  QE4$   04 H  E [04Q: R*& `|#[R5`V*/0 @00R <@00%0S0S00ą ` 0``00 J.0`V*Y(Kx3.h0l -.V\ VT VL V@ .@YoA-A]7A-A5-AD-AY-Ae-Aq-A~-A -LMR@po`p80@P S<0:l=S.08Q D R<" R,T0 3/80S'd0S 3/ L80S?ʬ0o 0,R@ 00 4o |[]0Ԡ

0,! ,! ḢL!4 * #/X100T!\003/P#   c?0SR 0x`) 1001000 E)/@@@-A .A -LM@pDoQ<05&;-0K/ K 0.0K|`/f-#VE -V@ Vd0/[1 ' 0. [: 0h0-[ 0$3/V``P0W/I5  0Sh0 03/P75 h0 0 3/P0WP 0 `(K -L`sHP@l0Lp0u0<0S2m[rP'$0 $03/03/$0 `YC0lplll~oUSPUN-0F P -LMP`$@L+D*`0000 0 000000000$0 000 8 P5/ P Kh7+P04P800@PD00P02 X02t0\@`PdPGP6l H2l p.l *l,L/2p 001 001 00F1 00N1 00V|x1 00^sX1 00fj81 00na1 00vX0 00~~O0 00u$0 0Pe0 t0 FqPt* 00 0TKh@Q.A\"T"v.ArA.A.A.A.A.A.A.A.A.A.A|b$"@$" p-LMP4d0`@ P0@@d0<0 0`40XP KphX*Kp@J}A".A -L M`Q00@A PF p㴡1J_ RAWI1 Q PRB RttPUPQPRPWX '<1Q PU(!8 '1Q 1U!  '0S '' &Q&V (KW p00 &W00l&t0WdUpP&U,&P pL`JO RU /AakAoA /AAA/A#/A2/ABX/A`/AA/A -Lo -H`PL@j000 P0D0L0D0@@D@D/Khk - PL@UH`j 0R0D00 0 00Khj 0-LK 0@0pPj`0SXK0hj -@p`Lj0 03/p PYjW 0KhB|b 0 -L  Q 0 03/0S -L$MPj`@P6) K0`P0 0$0 ` 0 $0 0008.  p 7/0P@4 K0pK 0 `p0*8/0P/0g?088 8/0P,0 8!8/0P008i/  8/P $03/(<03/ 403/03/W`@m/A 0-PL@ 0 $0 03/$03/(<03/40, 03/03/K0h,` -L\M@X lK 05K0lK$0 K6$ -`0L@$0 3/LPU 1SS p-L\M@P`X tK705KH0T@9C>H0tKX@ ,0 P $0T0  Kp -L\M@X lK 1A41A^1A1A1A1A -0L@P`&0% m" h"댐匀I0S V $`Z"VTV"2"<O" (I"$KkE"1A2AakAJ}A@2A@2A -\0 L@R0%00'P&0,0&JoNOPVP(!q> -LXM`Pd@【pX |KZ0|K6K`` 4 |P ?o\ 2?_@T<00P0S\00$KC' -LXM`@QpD; ;0@P@X tK%505K20,0 0X@ 8p 4` 0 3/P0 03/`T,0tK@00` ,0 4K -L\M`pPPW0 T@ D@@X |K406K20|K40 `@ \00 K p-LM 0PK 0 000e100@P _P P 00 0Kp 0 #^P  U 0(P0 0 40 0 0 03/ ` PP, 6PP Z$꠆R2A}2A -L@ 00PP F$0000P80P0800 03/P`p H-$`0p`0808(0S2A2A - LM 0K c  F [ K -LM 0K c!  7 K -@LPQ `H@    0 03/P (#D`P #000!  0P1P1 R004@T 4/P` |#03/0pP`PQ2A2AP2A -0L@S00Px`xpf 0# nP0S 00W0P0PU< |b+(B 0-0L@S000P< 0# K0hB -LM 0Kà c  D[ K -LM 0K!à c  4 K -LM 0Kà #  $ K -LM 0K!à #   K -L MP`@p@T0Hp@  K@   P@@D -L MP`@q@T0Hp@  K@   P@@D -@`0P@Lc 0# Khd -@`0P@Lc 0# Khd -Lpc0P(0S@Y@P YP` Z `rP c0S00(0 3/00000@00c -PL@0(0S`xc 0R000 Q0 (03/0cYKhY 0-L0@(0S0PSc|0StpK0hc -P`LBc@Tc0 ,0Kh/0 3/@ 0`( "4`#/ -LMp0$ @0 T ` K␠K ``0P*5/PPM0K0`8P0 5/PPQh1P0P0 5/PPA(Z `0 :/X K0YKH0 00<0 $0Dp @p 0KT0 )PP$0 ,`V 0 006/ L YP PP $0 $03/ <03/ K403/(KY rZ -LP@<@l`hQ -LXM@$0P`p% X |K< W80 006K0@ 3A3A3A4A(4A.4A44AN4A -P`@L v 0 8W P= PN0 00( 0@D1 rx <s Hn LXi `[d1 a ,0n PLWT0D!2 S@!@1 6H `'C``@a H;DwP  r- <6( `'#``@a H D H LX  `[ 0 a ,0Pq>f4A4A - 0LP@5  p `` dX hP iH j@ k8`l 0ma p tx"5A 0-LXM@PX lK!05K0lKPP $0 BK02 -LM$0@` ,PP (KPP 0& P1p Wp!04Xa  8/PP{$0 Z 0KĐK0 00*:/PPQ0K08P0 5/PPU(8P0P0 5/PPE(Y 0 9/X K0 KH0 0D0 @0 7<0 306K$00T0 PP$0 ,X 0 008/ c 03/QP P $0 $03/ <03/ K403/U /000cQ|P xP  < !4  4K0  0K (KXP$0% # $0X K=06K20<0 0 Kh0 pP00 3/P0 0   P1Sx0P1 R0W0 S 04pW 7/P 0u夠 y)0p 0$0 p0KАK0 pp00*@:/P0K0p8@0 8/Px40@0 8/P(Y p@0 9/X K0 KH0 @0D0 @0 4<0 06K$00T0 Px$0 ,pW 0 0@07/@ KfT1  0K,PtQ K 0   P 08 0 ,Ga"        U 0R 0K P 0 % P000  0Io`"##0媢P14Z0 3/?P@dPP oP $0: $03/@ <03/ K403/XXK] K nK pcK K KW p0{בpS9 S6?Pw 0S Y Z ;pP PfPP ` l<P~2A r?5AY5Aq>z5A5A5A5A5A6A6A6A%6A@+6AD6A 6A -LM@p`040 Y$0 p0 P 0 PPlZP4Y(K2 0P 5/PP,0SR$00O @Ÿ ,S000 00, QP}#.4 W0 0 2"14 0P5/PPh(0S 0 0 0KPP'DQ0S   P U   Q   U 0 Z0 @`0pf! R! P0 QRv 0S 0S 0S 0S0p0 7AcJco8A7A8A=8A 0-0L@S 60h S 01 00SDK0hJ \\ 0c P-LP`pS0 100@T0S0 8/00@AT0S0 8/@7Ac P-PL`0J@P0 P0`00 R0 4@0@@p  1S R  R 4      07AJc8Acc8A 0-@L 0R 040 K0h\Jc-0^ /$0a(!"$a$"  b"!4b4#0/0@-0 #? t@,? 0#?00R0S00@,? { BP.?  ,? R\y@,?j AP.? ,?R\f@,Y AP. ,R\S@^I @PU @o T\D@^< PU @o T\5@,?. @P.? ,?R\# ?\0 t!?Q /o" ?P R000000000ꤑb W 0-P@LQ P 0@0S@ -@Pp`LV W@p P` - L0 Pܑbb8A/ 0- L@q <Q 0(Aq  0 9A9A9A 0-L(M 0P0 00 @80 0 ,  (  08 K$0 P 08 K3K0" -L0 4P9/ 40P3/Y  Xf 40P3/Z  X]~X0 0 !0< pP7/ Hp e 8 0(ps1  P ! W0pH0 0@0 vPw 0 H(K~>~c,bb-9A0AF9Ai9A@9A@B9A@&9A9A":A@:AE:A@M:A{:A"/G-MA 9090:0; 0808 Qar᠃0000LS \!0 1\Ѝ\00S @003@ @D 1(0=0@00/c -LL 0S 40 Kh/0S c:A -0LL \ d Kh/\ 0 c:A0/c - L@0`S P p 403/d V00Kh/0S Q c:AN  0O   ! "`"Рo -@LPPL0.  `@@D(0,0 Khjd_>b0`0! $0 / b$c 0(0S 0@o/$c@0 "!/ 0-L@'q  PPPD UT ʀ0 ! 0$ 0D@0@;A$c 0-L ! Kh 0-P@L|(PA $0hP$0 ,0KO  R(*,0`1S00!0$cT;A@" b 0-L ! Kh0$/$c -d0dPL`q$0`Oo@dt$Kkk1,Pf10, dP2/ b$c - 0 !x0\ Q    D $ `10U   $c b 0-0L`APf0 b 0-(0L`A0P !10 b -LPpZp  P00US\ 0!H@a10,,q$0`11 0,l;A$c b 0-L@1p  P`0,  DRQD  @!0!0,1,oK0h$c;A@" 0-@L0dPH 5/,0 K0h/ 0-@L0dPH 5/00 K0h/,0P 0 Q>0//Ԕc@ P- L 040 Kh/00S s Ԕc;A P-0L  d Kh/ P 0X Ԕc;A -LMPpi@p00 00  ` 06/PPXG0La 2/y/, 0 4 8 < @ D H L P`o  P   O R0X  P@KhH 0,0 0@Kh ;AA -Lqo 0-H0L0@ !0 4P5/0 , !0萖b 0!< 0`4 0 (   !/ b$cDcHc\ `P/0 !`8 00 (  , !/ b$cDcHc -Qp@L 0d`6/0 `aP0d 8/0 48/V*V00U03SV010!SV0`4P 5/ P0d 8/ P 萖b|b -0p@L0 dP5/`P Pd08/0 48/V*V00U03SV010!SVm0`4P 5/ P0d 8/CPL 萖b 0-\0L@04P 5/0 00dK0h/ᐖb -L M@0\Q\a\!@00_j  PD p8 $p `0 0`0.0` 00&0dp 7/0dp 7/ 0 dp7/0dp 7/0dp 7/0`0 KiꐖbXdXdP1|b#>A## -LM 0CL0F0@l64&0S 0  PP@V :`Fd0 0S B `FVK萖bQY' -pLP@`0!0 48/0dp0 7/0dp 7/0 !!萖b@B -8 0L403/d`08 6/ -0` Pdp40L@3/ ;7/0 4P5/`0@ Pdp403/ ;Kh/- 4/14/-4/-4/-4/- 4/-$4/-(4/ -L@`?i -L000C`0J0 0<0S 80S S <0 0F"0 80RT<0 0I$0<03,0D00  J0壀000 0@0,`0 000S0@0@0000L0@GPPBEQR0<0 E8 GP(K8 @03/d03/00K4 KP0 L0 0R0@ 0PZf$Q <0@ 3/ R 40P3/<0L 0Jcbvcd_>bM>Ag>A -LMP@D00 K 00 `".6/`P #00!01@ 00P$ x 0 0dp7/P1 R `, K  P ( K,@$0|@4p80$00 4 < S 01D0@ 0S0009Qd  V0000010C? 0(0K00( 8/,,0 0(000 .r,{>A@>A4 #b>Aܔc@ *A - 0LS Kh+ 0- 0L@S0x K0hP /P/ -LNM`@pPJ/QK⏹V/ ؞00000 )`P`KKKϠP  @! QD A 0-@RL 0 0R 0R 0R 0R0/00   (0 00D00 4P5/ @o_W@@W@AW@EW 0-LM QϠ\@D@_RD @@ ^   4/K0b-0 4 0/-0d / 0-L M@<0PzP R \ R *R!SH  R < &    q D @ D<0  D!)LT 0 P\LX`` 4 ,PP@\P Q  R QZ<0ZSM(K0::0C: 0S ,0S \ 1 !10R !0X4H << YTLT XP0 HLTP0 ,Y`@` X\ 4 ` B X``\ 4  ::0:0 & P -@`qLp⁁::SY20LR M"L"80S0pYd  P  d0%S  DPQ  -LMP4  P p0`00 400  A  !0 B80 T dcd  P  &  R Z 2/< ReZl 80 "LMLbD q @P Q \Q YU  0@s S"4AQ4 Q#, 8,\ ,0@8 @8  Z 2/ p00`V000 s - ( #(K ** * YP qꂑ0S8080001@g>A -L M0pS@` V(0S% icP0  P㐠 U(Kq000 S0#03 0 Nc  P0  0P @HS -LM`p@p0000v 00 P0 5/PP l$(K胟 pL2@  @X c  P ("( 0 00 00$ (0,0 0S3 0Un0 on2U]L^M]2L2PUP*00K0 PPp008/P 1 040K08:8/0P i(:).  p 7/0P(4 P:5/P<:40 *΄ PP :^40 ` 01q ʁP”-?AXD< :RD01 "0D20LML q @0@0 ** * Qc?A -X2@L4P\d 5/dPX”\0d`0d 6/DX2\d 4`6/X”0d d\Kh/' -PL@PPxP xX `"R X2\`6/0`2 -L MP`p@0X20`rxx0`VX?0  0 8/ P  Ki0X”`2(P\5/ YX2d 4P\5/0RX”d 0dp0\7/X2d 4p\7/X”0d dp\7/X2d 4P\5/1X”d 0dP0\5/X2d 4P\5/PGX2d 4p\7/X”d1d dp0\7/X2d 4p\7/X”0d dp\7/X=dph \7/X2H 4p\7/X1dp \7/0 Px1 X2`"\P5/0`2@ P PxxX8 ᖹp K@H@'xK&$@AC@A# 0-LP@_  PPp0000/-0*T00/-0 T00///- $00/$00/ 0-@$0L 03/$00K0h// 0-@$0L 03/ፆ0 p-L M>0 `B@ P  B` 0ŒQΌ Q @=0T00 P05/P  0 Kpb@A -0L@P L"00T0X 4`6/T0 d`X6/Kh~@A -L,M8 #x0P d0 S S04 00 pؐؠd0S (KS CS4  C0 40KA(0@8`b(0`03/P 0@@0 ` 0+P  p@A6#@A 0-@$0L 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/P0}PU03/$0 0 N' -L0P`@ 0 0T @ ` BT0 0Kh/ 00-@L  T 0 -0L@ 0!d:/0( 0"( `0840 3/dP? 5/00` 40 3/``40 3/ 4AALAA p-L M`P@`00"00 `0 6/P ldKph0<Sb@8008000@ 0$0$0000Kph5hAA{AAAAlS#pT# 0-L@ᳩP 0SW  P<00000\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -LMP`8@@ 0 4p7/@ K 4K⍪0p4@ 4/0@4 8/P?0'0K$3$F@)@K@4?0(0K0+0K204 4K,0K0@ C -LM@08  dP5/ K4 K'0[) [+`[?(0[&*3?=0* [0PXX@p̑4 t0`40,`[ZVbn`RPp0d 8/0d` 6/]\///- QP0SP0@00d$ /AA Q/0AA -0L@4P 5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/ U4$KkPU80 ||b!BA'BA<0S 4//D0S 4//@0S 4//80S 4//\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -L@`PT0( 0T0d`6/Kh -L@P`T0( 0T0dP5/KhQ 0-@L(P H00H00P0K0h|e -0@4PL, 5/0P4`( 6/P |PP0S   H0_ P0@0S P0<0P0H0@$  P0L U  P`H0p6 ̓,p0< 4:/< 403/ X0L00 4p7/pH0p  p<0 / - rU  P)H0 0S%0L0" 0< 48/04< 9/< 403/2$p 4  (p,pLpL0S@0SH0<06U  PH0@ $ P -0L00P  PP0Si  `  P0L H0 P0<0P0H0@$[ V\N \PHV P` PpP X` `0HP0H0@% V P0S+ڵ`P ) Y%0T,0T0@ 9/`F0`F\T0 T 0D 9/VX0d`$ 6/@;BA -L@GP0d` 6/0d` 6/T0( d`6/L00L0I -@L`$TP T vT  P`@@4@ -L@P `T _T* Bo0h TP@0T /0S  `M@ l p0d@ 4/0d@ 4/@&`BA -L M@Pu10 d`?06/14 d`6/18 d`6/H0` ``` `@`0@`SlPaD0P000 9Q00  (0L0 (KorP d:/0d :/0d 8/H0<0'%H 00`@,0  00000040P L0L0H00H00P0$ $00000(0S  P $@ T0P `zL0PP0L0@`dp0 7/p0 d`6/0d` 6/\``p`P V0B?o20SP0S<00 y`FBABA;BA|bBA -L(MP!@P40 0P 0 P05/pP F p$K*0"P 10P P5/#S  P>N?d0d0d2d2dh0lS  P;<PH`\0`P`O$\2P0P 0 0@0!`0P00  0 0 P0`0 P0$P0( 0,`1,P(0P$l> @$0`!`$0P$0$0  $0  $0 $0( `$0,P$00P$04 $0 ` <K08@ D0 0@0 040 d000 h0,0 H00(0 R  PH0(00(0  DK$PY|H0P X$P TBA@AAAdY#BA,L NBA@ACAV#DA"CAU#7A̗b>CAP0P ?R"0/ -@PPL``10S00  R  Kh10 -@L` F@PP 00S `pa1@ T@  L0@0 @`VL00L01@@0cc -l@L F@XP``51@L0 T0 L00P0T0k10L00c -PLL墬@`T 80`pPH0100PN10cs> -PL@ᅬ``P0A@ PpW@110c 0-L0L@ P0S T 0P00s00`RT0(0C d8   h L000c\ `P/0 !`8 00 (  , !/ b$cDcHc -X0L@S`P0XPFp0 0!\0`!TP H   !|KhYcc b$cDcHc 0-P@LXPi`0` 0?S5ywD0\2 03/P0K0h|bSCAcP) P P- P /P P/ P  P Px/P P `P\/X/T/P/L/H/D/@/</8/4/DACAQDA~DAxCACACACADA:DAhDADADA^CA --@LM,  KDALA -L0MS@ 2R 0 3/cs2LKH K03/P0S pL 0B S񟗎n#xo#o#o# p#o#o#o#`n#Lo#o#4p#$30S* 0S P000  00 0203/0S0S 0020S 0SP0002 03/203/ 0S P0000S0S 00 0S2 0< K3/} oX0Ss p 00 0$ 2Rf0@ KDK3/2< K 0"Q11TQ]0S 0 0X0S 00 0000K0S0S `X0 `S pXpp0p 0?0"vH 203/P WcDADADA bs>|bEA -@HpH`L`P.,/ᙊ 0 u|b EA -Lp`\`P@.1W 1W 0W% @|1W' 1C7CW2 03/@P3 @@ 410S-@ @ !000@.5 000P0S#@ TL0|0 cR(0B,dP00CP0|0$0S 0 @@0 0 0@0000 @0cA @A A(@EA bc Q-L )EA0( o( /c p-@L00Ņ0@D0ŅPoAFAakAA p-LAM 0`QP @ @ 8G/K< 0G/KKpJ}A-FA -p`@LV@0s5 S2 r/ PPE_oRP! Q :P P Q 1PP Q (PP Q P Y U @`FPY P 9/P 0-@L000K0h/ -X0L (?FA -L⪶<1 S=PA -LM(0@S `,/(0~XPP01V PPX P D ARJ:@ PE,,00@@D  BD H0H0L ]M YN UO QL0P  BK(00   C ?(000Q?0@  Q T RC G .X00X0 K0S 0,p  8/P H 0 D  p 08/P 0  2/$垵!PFAFA -(0L@S `X 01S 0S P X00X001S 0H  2/ 0,  2/KhX  D  BQ:@ Q0FA -L MpX0@P ` h 0p 7/P  0L0Q0CL  RL 5P SP0 KFA 0-X0LP @ ~00K0h/FA -LMPX0@`p \iT0S L 0 P P 5/PT$\TK$GAQGAvGA 0-X0L@P 8ET0S( 0 $ 2/0T00GAGA 0-LM@pP`ᘡ 0S 0S$0ø0ӓF&@`0SAʨ0S: 0 SF,0㓆&X3 0 , 2/0 S03C SQ P 4 00 004  9/P$0` 0 $@ 2/T (K 0   9/P,0 0  2/$@GA -pP(@L` 0S P`0S 0 P 2/,` 0 P 2/$` -LM`(@ 0 Sp 0 SḀP+$04X@I%$X$K0 !pP$$  0   p 07/pP,P0Sʨ0S$ 0S ,0ԀLE), X 0,  2/H#4 -`@$p(PL 0S @,p0S 0T!  2/@T#4@ -P@`LT6/PP A(@Khl 0-@LK0hB 0-@Lhf0 01 0!0!!01!(1 1!0(10 -P@LT0`P^@qZ -LM0@Spb S S S 0S00!S  SW (K"S S0S00001I0S 00,P5/1 00,P5/P`1UV 000,9/P V1BP`00!01P0`!BP00S 00,P5/ 0P0,`6/1 00,P5/ 0P0,`6/1w0St 1S 0s011S 00,P5/1\ 0a0,P5/1SO 0SL0SI0S SDPB 00,P5/PPP 0pRP3U`.W\p*P( 00,P5/\ 000,9/P0S 00,P5/`` 0 S:1S 1 00,P5/P11 PVP1P X0C/ӛ    000,9/!P 0 0000,:/!Q0 P 00,P5/aPV 0?@Y C`P JC/011B/X0`1 a 00,P5/P0000@000 000000 000,8/080 0<0 0@0 00 P40 80S  ,0 3/0S0PPSPPP<0S5 0S4 000,8/0 0000@0  00p 000,8/00S 0\0<0 0040 0P80 0< R@0S4 0S 000,8/0=@00@000 0<0= 000,9/  ,03/ P00`0F  R S# @Sm 000,8/00S01>  X"0C/P8X40YF*  ,0 3/P:8  ,0 3/P40SH S40080@S fS8000$0(0<00<0 ]40 S? 0S   ,03/   ,03/   ,03/   ,0 3/ P  ,0 3/P   ,03/  ,0 3/P80S? S   ,03/   ,03/   ,03/   ,0 3/ Pe  ,0 3/PX   ,03/  ,0 3/P?0 010P0 P00 000,p7/ 0p00,8/0P0000| 0Sy 000,p7/ 0,,  P1+  + ] 000,`6/P00 000,p7/ 0p00,8/ 000,p7/ 0p00,8/P"  1040 18 > P  0<0 0< R40S400  ,0   4 R; 3/40P0S1>   Z㰠  Z,0    M3/ P80S800  ,0   8 Rd 3/80P<0,0<0 4 R 3/  ,0 3/3/   ,03/ @  ,0 3/@0 Z 3/  ,0 3/3/   ,03/ @  ,0 3/@0 8 R 3/  ,0 3/3/   ,03/ @  ,0 3/@0 nHA -LM " 娮}OK    0 3/ P~?K0>K0@`; 6/P 0 3/@$1  1 1 1 01 0@2 1!7Q01 wK23/P5 0 3/@0}K 3/(K ,03/P1 0 P ,0"3/1  CR #l#l#l#l#l#l#l#l#l##̠#̠#l##1~oK~K01 0 3/TV 2 S2`p02 2"S}?K0; 8/11 11 2B S1001 01 02 ,0 3/P (,0"3/P !,0 3/CP!,0 3/IP!,0 3/SP1!@001 OP!-0C?o2 2 ,03/!@ ,03/!` ,03/!d ,03/@<@2 1!001 P! ,03/!` ,03/!h ,03/! ,03/!p ,03/ "Fh`V0SpY2pW 2x,0a"3/pP @H`Q!,0 3/ 0 !RV wK23/P !q  ,03/@o!q?K  ,03/!  ,03/!  0,p7/2"4p! ,03/`q?K1 @;@2"SSgڂ1, K A T, K }?KT0`p; !8/T1001 01 202 HA -@LIM.MK# 00 0K/0  $!(! 111 1014!(M/Kp0>   K訉# -PLZ@  Q4R( R@I`t0S V `V2(1$!0aVKO0S$ ,Ko|xxy `r0 S1`######ȧ#Ч#ا####_  [@T`L\0S9ث0 10S S)& 0SR0S dpXX R^Q @<0 , 0 0 0 0 0  0@ 0 0  0  0  0  |Audq RQ  A$ Q AQ p,3HADHAPHA2AakAJ}A@2AJAcHA{HA@2AHARIAHAP BHAHAHAHAHAHAHAIA(IA:IAEIAkIAIAIAIAIAIAIAIAIA[BJAJA&JA1JA=JABJAHJARJA\JAfJAqJA{JAIAIA -p`PAȁL$!r0A?o20S (!r0A?o20SPV QS `PPPM QJ WPGZ,10S ު9Q Z 2.Z*CZ hPPh ῔0 p 0 41P041CsP\ C/媔010B00 @TXs>JcDbJAakAJ}A@JAJAt> -(0!`prL0@?o20S !r0A?o20SP(h%Q ْ@P P Q ВP(j%Ṕ> 0-P@L 0 P@HT00 -Lp`f`4@S@ \TV%y@P 0-0@LD \ PXP \PP X\'0X40y% 0-@L\xX\0X400S 00CS00// -L0M`QP@ \4KA]KA -Pp`@L@4 ,D8/` V@Tp @`G@4 ,D8/@ T -LMp`᫩@`` 0T\4 P @(K 0(0  R0@000P 5/P  @ @$D0D4%PP2$42(4GUڜ1 0 PPQ4 K:P $0 4KP $2 442D842 424 2,4204@4,:/P00H4$0 00  1 441D841 4141,4104@4,:/P00H4X 0S R !0R "0RH$R0\P5/2 ,P5/PP2 ,P5/pP0440840 40,4>w0Py #P0 #P0`44s@L#zKAKA##KAD%d%%%l%4%\&|&&&%L&<%T%$%x%%%KAKA -L`pᯨAPT z@P# -Q@0L UP`5`P l011D 0(1S5Q  T%NAb 0-@LK010 -L`P[P 0@1 c P Kh 0`(0 \yP 0$10\0010 1th0h h#PXf0$101Kh KhE#zKA #T#J}At%%%@0S 0S00// -LM 0 R 0 Q0 Q0!RS 0 ( KQ0 Q0 > -L Mp\ P0`h06*U(K@0 U@1K#XD  $T09/pPE P 0 -L Mp\ P0`h06*U(K@0 U@1K#XD  $儐09/pPE 倐 0 -L@`ሧ4PS@y"ቋ@P -LM 0 R\0S 0 00OP00 K<> -LPZ|0@`V PU 0P  P PP 'd!Td% -LM`/@$` 04 5P  0 P (KoW 0(P000B>40 0h000 0S(0(40,40p\4F>00 9/PC(4Y, 00 0p0 7/Pp@0\4D0`4Y0STL0h440L00; 9/PH10D100:0 0P0P  0  @00P000l071pP0<00 00 0?0bW0 c!P"Ὡ04(KX(4h444l400@##zKA0OAKOA#4#<>#|bpOA0#KA_OA0S 00CS00//0S Rʬ  R 0%*0/ -L6J(2`SP hjPPTQ $$N -@= LS0@  P``6/0 ~b-=R B 0`6/-0 8R B `P#85/P 0 cb= S @ `PA05/0 TbDPA -@L$M`80 P *0 SP*0 SP*0 S 0K40 0K.0P< U*0S X `08 0@0 < 0FS2(K0`p d0`h0Pl0Ut=S3: 8t #8:/= S< x 0`:/=p`=S00> 0| 6/P 0p4 8 `8 V< V V V Vt Vx V|@ X* $X S B= S3: 8t `#8:/= S< x `0 :/=p=ppS> 0| 9/~ 0-LM01 0 K討>0S  0S0?S00// -LCMPp U@$b 0p#PT  PP T0T=P 2S P0 # P ! `ԢԒ0 Ca-=R0 ( 8/ P =' S  ` 08/= S  `P28/= S  `,28/= S` ( 98/`VS  ``06/= S  ``06/= S``  06/ 00`` 6/ha-=R0 ` 08/`V= S4 h ``06/= S: t ``b06/= S< x ``06/=KoK@=S0> 0| 08/0 SW0p J?KlUPOh(KrTQ $T]i%Ҍ?KPADPA#E@> -LP@`p@ 0`$2  P H$KkC 0( 0=  R R " R pW-0R @ 9/AP rpP0}\=幣 \0S`we0P  $Kk P _!0(2 @#zKA#@cPA@/00S0Q."0/$b 0-L@ᠣ R0`0S00`P0d\0 0-@L⊣T0 0-0 0-P@L82S0 0S0820 \003/ 0-@L003/K0h 0-@HPL0S00  R  K0h0c -Lp`=p@P00!0 0PEU[0 0P WPP2S`G003/H0S <l0Kh蓑QA@Ğ?QAQAT#QA$b## -@PL}K 08"f<喑@P` 0S ``wQ<0|b -@AP`ML (4P <8` @0`P0 0L000 TP[pP`!P Xp`\Pd0P t0 0p00l0xpAPP  PPW| K $0b%0P(_cRARA#RAJ}A#.RAP#9RA[RA 0-0@L$0P OK0h@Mcc -`PL p@TJ@T R00   @0 3/0 0 -L0M Q`P2R 0R @Bz 2R4! @s @pT@l2V t2V0 =`X2Vb 5V0 0P  N0 @J ` V0S  01S V? 0 L0 L0KD0 0#K00?00 41D0H` @ ,0 4` E00SD Kአ@PX!   1  P@ @V@T 00SD Kn@X $K0 C~Rt 0aV E@ pW qXW t0 0$@d04/P @ӻNTR X@@}f@Mcc0cUU@UtJc$$ H00- 6PL @(P 0@0 @0@Mcc$b -@LPTT0 6P@`@0P@H000Pc? 0- QLd0 @T@ PP tD0@00P@ 0S@@$b@Mcc0c 0-@\ LP &P@ <QA@ 000S$8@ 0c$b c 0-P@PLP Q.ᶊ05(S0 00M00C00$b4b p-@LMP,Ko"K /$0P0 P cR `0e@QN@@@( 0S ]|Vj_6Kpc$b -LP`Ꮰ0@S!0S ~0

-LMKAKK1K K 2> -LMKAKK1K K -LM KB$ K 0KAKK1K K K# -LM KB$ K 0KAKK1K K K# -LM K 0KK0 K K# -LM K 0KK0 K K# p-LM`@IPP  (Ku40 $0 0$K K 0K0 (0K0KcKp p-LM`@,PP  (KX 40"@KDD!@K2K0$K( 0K K K KEKp! -LMpP@ `P  0K 7<0*K)pK2K0 (0K0&@K,KDD0'0K%@K#$K! -LMpP@`P  0K <0*K)pK2K0 (0K0&@K,KDD0'0K%@K$K -LMpP`@P  (K 00"`K!PK2K0$K( 0K K K KK! -LM,K KAB$K KK  K" 0-LMP@P0K0K 0$0S* Qࠓࠃ\ࠓ^ !R R0 -pLMP K`m@P@KP @ 0P 0 @P 00 "=-LM0 8 K0 n K -@LM`p 0P@0 U ^ K < 0-40L@$ SP0K0h|bSASAgT 0-LMPK@K!P 0St 0SK0 p-L M`SP@Kp$K$K$` $KP 0S St 0S0  R  R  /0 R -L`p Px0 @P o@@ <-LMKK1K K K K K K K00S/ xbTA -LP`p@0@T  0Kh/0 xb(TA -LpP`H0@T  0$Kk/0 xb5TA0"P/0  Q0-L@ ( 00CTALTA^TA p-LLM@D 0 E00 FČG0IPH0@ < 440 D0 0@8 X , AL H ( BT0 P0 $ 庄x0X Kt0p00@0K`P ï0d``0h0p0S Bp bKp 6lTAt$uTA -LdMP0p@Pᠯ0`S$E0DF IG0H@ T $H0P `P 4PL0 d0 0H0xP \ 4` 0p l h t PF0 0U z(Kd !R8 # 00S D0 0Y00@0 000<0 00080 000X0 p0  r \Q Sr0x K00 0`0K;0P p R 0 ŕp Tb0 Qd\0hh Wʨ 6TA#uTA P-0L   ?@c -L$M( KB$*K' K @͠㌀0`K)K"K`@ ,KpPK&P00S0S &0K%K0P,KP00   K 0-@Lt JVx KRLp K0hL -L@P`Pp 0Q00, 0 J8P# 0 K/P0SED 0$03/0S`GEF0D 4$$Kk/tQ AOxQ  ;Oxb -0ML0B4  KTA -LMP @n0-00`0 0G F040E D040 0X{@ A `@0  @?0>HGI0x  G/0@@0G @0G, 00(Ko&TATATATA -`QL@ P P $   F}ACTA -LP` @ {0-09"RH Q 0?3 ,  B%# 09QJc|bMbTA - 0L M`,0 (KA4,KP'0K"K*@P p2 !@P0 0pW@ K L@#@-0@ 40P:PU`S:pW UPU@T\ 0-L@0Č PP00S0 0Q0U:\ \Q T0P: -P8L`P pP @ `PUP 6 0 P 0 R(PpWX X0 P( P/  0P X 0S:P  h0hR`P 008@ X  TATATATA -L,MM0@SpH 4 0SP0`P w!W (K`V8eᴬP0ᯬTP 0ᨬ080P0T0 08 KP[XᔬP``0 qP PUᄬU 0}0T00S0#[4R  00CS P!@ KP[YP [PP 0 8P Z KP0TPp0pSH0S 0<噒0 p 0S0#[4R0p#30 0PZ j p8P`0 0 P pW:8pZ@UAAUA -LM`QPp @( KP#0[S  K@M0S -p0LP `ҫ0`P @  00 D008 < @p 00003/`P 0 巫 0,@(00000400@H# -LM K 0-@L00uH003/00 0  00C000 K0h~ 0-L(M@0D ( E0 80 $4 GF $0 IH $, @ H$ A B  8 K⛁PP Y0dP`0K0UA -@L0pSh`P`M0V S b0 AP  WPP ኑ 0 P0 !Pd `0 ihPZ`dd`h00`PUAS0@- \|# | ^| ^| ^`^0@0P ^d@ QU  ^0 ^0@& 0-h0LXM\0 7X0 T0P0`0K0T K0\K#@P`0S@ TK{K0 -`$ GF $ IH $ @04A04B04 04 0S004 04`0S0V "4`spQ  1Id0P rJ~p G2೔``0SV\0S4$K  NR00 R0Są \0B1'<0S01`00 400AQ 000   -@LP X80SP0`P,PP 0TP 0`Qdި0`0tP רxP ҨpP ͨ|KhȨ`V8eῨ -LMp @T `0S5P00 0Q P0o(Kd01S @0  <KBI@0 |P<K ?Q 0:7``0S`PCTAVAVA -`XLPP0 @T pW\ ^AX   Rx PU0 X @ P W- 0  4 P$ H \\\\\\ p? -L訕c -LMP`"p0SG%,Y0 `n`&f`00@P0   00` 6/PP00008`0 6/P? 0 ` 6/P/`06/`P"@Q Q$ PP:P :Q((($0A$K003/<0 3/40 3/ 0 ,ቧ fꜙbc -LM`Q`0@Sp DZ@X@T0N0N@000 PpP 0 p~ K7@T)@(0K@ ;pP(0 @0( @ 0@0R  S@ 0Pp0000S   0 M00S @ꜙb$cb -LM K 0-@L 0x0  Q$$((0   DK0h     0R  0ꨕcbb0@-00^ @P0 U #00C0"4  RP -L M (@T 00 4/  ,@TKP/ -L`g@P V w0P(@(`` 0-@0LLPm#X P9npW 0S000000C0(P 0 0 03/$}(000(0( $0R*G4 4Q p07"0p03/0P'Y0$T3$$'d -LLPp`@P) 520,000 t`,KoD -LL@p`oPP) 52 tt0Kh -L$MLP@LcV`P3夢0P3Lp 1 0Q,  F/oW" R 0 0000@0?P 0 %00` ᙾ`e0 o`VL`  p@0S  ( @PU` 0V:L`  p@0S  , DP@`$0V:`L n lMc 0 ps#p00002`0 0l$ 0V:  6`@06T0jP30CSP3(K$7`8*$WA%$|bWAWA 0-L@L,P30P3iK0h#LP30L3 0-L@LYP30CSP3K0hL -L`pᨉLP@L3S <P50 P05/P -L`pᆉLP@L3S P0 P05/P 0-L@LP30CSP30K0h4L/ -LPL@p `0M300S 3/3@030T3}i0 L0 m_P V$Kk -p`PLL@s KhL0O/L0L/L0/L0/L0/L6//L0O/L0SL/LLLL/LELL/L <L {L / -LPBN0`L30@3c Sh \i     先 `:6& 0Lp $0Lpk0\N3'$'$c -LM@LP`_ DB1Y`110pⰆ01f1110O3% L`!0021 2121202L0夂x1 00 00 }2S "  "  P $Kk聼0SG`c@0SdV0 0 X08/0@ 0  P|$KkXl@`1T ᝼$K)$*$*$3$D)$P1$1$(*$,o,WAd@#$XA -LL@PTp N3Sm rHL60`@ P?P|Ə!h0  /P30CP3P3SKhL P 0?0 0LP $0500g6&W R 00S @0S&4S#0003/`L0 b  BL` z6d -PLtUL@0`L pM-00S0  S/ᰙb -L$M\0pP<0 &0S 0S 00 0KP B[ < 7@03"\D  㓑!808  80 a Vb`` @  P@1 02`3 d800 0Dⓘ(<Ps \0Sp 03/m   $ 0D⒓#70S  #0Dⓐ 7 R7(   `   `@    80S   0D⒓#<0S  h 080  ]  KC BP(  ˺@<0 0S\@0 $0R PS Wp o%@P u%@(K0Dⓑ!1 0` V20    0<   8` ``V`0FS  |ϺQ @0 P  @n 0Dⓘ(7<&0"XABXAbXAXAXAXA -L0@\`V P0p 0S0pZ  \DP 0StPEHn 0\ P fP aP \5 P -Lpх@`0\P 0ST#$Q 0 3@ -Lpḅ`\0S P唷0E\ #<@T `0S0 PUd Qh 0 Bh `QhZd d`XA R-L@P KhZR`0 S:$PU 0$0Jo nKh   0 -L\Mp`T@Ps`P00pĹ 0S 0 CR %S50% 役 pP 0S `s^( TKn 0S_ 00CS[p5` KhKh0 7`p \p Xp d0 0^p[SW   !R00VK0MKT0Kn_0[RpKS0K]0[Q0K\0[P0K[0[O0KZ0[N0KXRp[0SK $4Q0$W040 uWC#P JP EP @X pGH80\04T KhKh0 8d0 R0[S  P R 01 0b0K0T KhKa0K, K!! R0R!0 GHd3\TK@0 00CS R  Bķ. 0&K 0C^0K`KC4]0K\ RPI` KSPB0S`P ᑸ`P1 00Sx, 徝 廝 嶝  m m0$0001 0 0`00@0 0OP WE n0 CR Sゝ0 }<@P6 78Qd AZDQBD W0\0  P 4 0 W00S y0&0%00 Pl(K@LAK}AYAoA@YA7YA*JBAA]YAYA):$YAYAYAYAYA ZAA$$ZA@ZA@ 0-@L⡃T0<0-0 0-L@ᖃ004 \000Q 0 Q0-L@ Q 0kZAvZA -LM`Po@p`0? @ 0P  0 6Pᅷ 5R0CSr %00 $00 R0s 4R60S.S30CS. h4  % P8G0<0(K   R R$ ᎶCS #S p  3  0s0 0S$0]S(0Ṣ?m? bmL[A 6[AI$m?ZA -Lp0@<0 P (P ,V`P00S -@$40P Ɓ 40o`P p-@ LMP $0K]T T Kp0 `R $0R0C$0 `Ӳ40P  0@ $0S 0    0$ 3/ K [A 0-SL$0]S(0SGS(0S 0SS0 (00,00/ -L$Mp@@` 0 P K0 08P0U80 PP 㫚0001 00@ 0T P@$q 090P5 @ PD0  02K$0K #0,0K0 0 P PP oL 00 00800 00 0PPQ$ 0-@LP 00 P 0 0P0@000 -`@L@p 0 0 08PPEU8P KhGF P PKh -LM @Rp006@$K`P0 0^j ` 0!@ -LM00 3 K -LM0 Q 00 K  K0/P0 ?R"0/ 0-@LCT0(1-0 p-L M`P5@PC1 000004$ K K` 0$ 0 $ 0 $ t勴 Y UPH0 P$/Kp Y$hX$@;[A^[Af[A@ 0-P,@L=P o-K0hv@Mc -@PPL`+0S00  R  Kh_0 -@`pPL I 1 0 1ℹ  1S 5Kh< -L`0@(1P 0尀p $10CS$1 ^<00ᤸP pᷳ`0I0  -ogex,4|b TA? - L|P5p(1S0S S L0`@H0P00P`0/c?$? - L p@P5 (1S2`| P Pp np P `hPP PPv 1,`0 1P01P/c@Mc 0- LlohP@:01Pw3LQK h0/c@Mc -LM po@`$10$1娀M  1$ P0PP0S7P K(PP0K ]}P1$10CS$1c&(K Ⱐ0SPY #P 10 1 5(1PSP 10 1ؐP0  U R S0#SP!P1K  K}PPQ/c - Ll`poPP@ (1S@A@ 0SE@o/c - Lpn@Pk$10$1娀c(1S`0oSQp  |pP0 PP pE$10CS$1⻷~/c -LM nPP@ (1S@`"$10$1p^(AT @V$10CS$1∷K(K4Yw 'C 0CY 0Y 43Y 47CW0CYf 1YQ Q Q00 0 SJ PmB0S 1S041 @1@x1S2 0R @vt,B1S  p x0R@T 10 1[  0R0S7@S KP 10 1 -@HQ Q Q0d0 0Y0 S@ zY 7eZ *0000~0 f0 ꂲ밐 @T 6M ᕲT 00$@t0 4/\ pK30K00Pe /c|fpUDUvtnU@McJc$$* 0R/.R/ : ' -LD Q <0Q -1CQ0 >0 W@ W Q-L :0S= Q Q 0= Kh 0= -LV|0> 0-@LN|T0 0-0 -L`@A|P6>S |Dl5 80 P i 0@ es[Ac -LM > K |.R! K pQ [xΐ, K XQ [`ΐ, K d.R 0[l1 0K0 KX K -L$MpLK P@ea,0K0 0SS: 018#(# 0 R R  x0@ T(K -LMp{P3p@0000]0副0 P*P KKG] `LKPf]P. 0 #P. 0 n"Pv0"` `n0"`g0 |=0==0=p2 R. X"4> 0 ,2@ 0 00 C[2P>0>N^0!Kj(Kt D"8S) PQ@ <L8P4T@S00w0xPs<0 S p A兯 =Q aU 0C <0P84,SU@S O@80 S 080 40 D@=S =h@<0=80=40=80=.Dq$@@c4?g$0>-[A\A[A[A[A[A -L M@K KT 0 PK -X`P𝤀0 !`!800 (  , ! b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc p-L M`0P KPV@@ 00 0Kp00C괕c -PL@0Sp` 0St00`=0=>S0=.0R=000 P B. lb 00P0PV$Kk괕c\A -LM0@P9= 8! `,K100#S> Q=!p X <=``  R cV ]KP cn K <=  0 P  o3V Ki.T? -P@Lp %c`耄=S2-! 0AP9= 9 =P<= <=  =0S'  Wc02J0  $KkYP 0< 030` 0S030$KkBd??|br$ ; 0 /ᴕc -LBy 0 0-@L9yT00-0 -P@`L pP Vp@P W@P @U -Lp y,`@b00P P UR00CS0 <000P #0S  700ұPP f=0P0CSt$u$u$t$u$ U   |b TA -LM\ (8#800 P K -LM( 0 P K p-L M@`=0PS  P00@ "1 `a !0 0@4 '00$ B$S&% 0` 0 0Kp -LM0S0040 7v0S0 0t0 K -LMp^ @0`PN͌ ĐȀp`PP $Kk$K 0-L@sP p0 0S $00CS (0S SPS0000 -LMP@U`p1@0` 00%P&P$00'PS <K -RLM@P 0P 5/K0S0 0CS8y$y$z$T{${${$|$T|$R00P0 R L 000S 000 P S  na0 000S 0 /U U 0Q 00S La<0S0  00  00& AR R0 0 0K  0S=0S 8S0 0S00 &0Sr  R 01:R00PR w0L!pS@a`x 0,SpR v`k GdP\R v`] 90 0R v`M )0 0sR v`= T00QP0 v 幨{%AA\A\A\A]A/]AX]A -LM0S 8 2 $ B$% 0   K! -RLM@P  0 Kh/0S"0 CR}$\~$~$P$~$P$X$$ԁ$U Kh000S 000 PKS  N`0 000S 0 U U0Q 0Kh_0S +`U #v0P#pSHc` 00t0 0CS000000g00U S0 0@  hg0 4i 8j <Ÿ SU0Bg0S0ih0j0 L0L k C$l C(C 0-0L@0PNo=0SZU - U 000 00P000000 -L@0P@0000,`0000000H0@ D^u00CS00l>!WB 0-C@L偈000 -L@n0P<00,`@00000D 000H000L0@ H^;00CS00ⱨt\$?0!AP/ -L M@l0 R 0> P ~P K ,0RnP 0S  ?! -LP@`0S '`pg`0`' p-@L MP`}T&@PFKp00S000 D 0-@0( 0CLR P0(00(0C40(00 00-LM@P0KYP K040KK0 0 KK PK0K,P[ p-LMP`@<PH0 % K2K0" K!KKK% K$K `K0K `Kp@ 0-L@ _ PUmx=H0~$  & ~H0  {  K0h-aA' 0-@LP  K0hd -D0LM@0 0K KK @K0K@KP[K -LPp`@ %p@ (l_(JPU<P& -LMp`@PP 0 (0K"0Kx0$D"K$K( K '@K!@K 0 e %9 (5O(@T<K@& p-L MP_@V`[~ 00  R= 080#80C?o2S?  008  ,0 00  R= 080#80S0S @P H0 0K Q1[ 0oAKp -LM@`P0CpL40 00 3<3 (Ko{ -XBT& А0 80 \P80 ^ " Q ,T=,K>S X" C@C@40K0 S@_T3<3(K -pLP@P`;3@`7`^,100 S`4V3 %  (`cH    V 800-0SL@`;q0ϖo -LMP᠂ ]H 0H00S 00S 40S 80S\P <  00 S0  S8 S4 ``PА k #g#EZtk ϜP!@X@A`0 0ꀬ?@KAĚb?aAdaAaAaAaAaAP/ -LeM`kkp@>P 2` p00(00,00 0$02@ 00!0  P0H0HPP00 $ PH +,0P ! P! 0 S,0 00,0 P00SP P P㸑 1U1P B(K40 R 00S 40S 00S@P,    R0 RR4 P40S  $}PU*0 @0ATjE0| $k/KPk/K@P@KAb?aAaA1bA bAFbAZAcbAbAXdbA p-PL M`@H0 T@D T&@PFKp0 00 -LMpH0`( 0CPR@@0H0 (AK!(0 4TK 0-@LPZRPP  oP-J0 -L M@0!  4 0P  P$0SK褬?0@-< @!@@ R0$\  P/ -LM0   P  Ktb p-@L MP`T @D $ R00R0S &@PFKp00 0-0P( 0CLR@ 006(0 0(0 C4000 -LMP`iP@凝/#p t3+ P D֝81 P00(00,00 0$0<`@00 wPP ᾝK9p0S0@ $K$0 8 0 WP Bi坚0 P `  00 S0  S8 S4 P@KA?aAbdaAbAbAbA p-LMP`@@P <0( K$K$0 0 `K@K0K@KP[ Kp -LPo@P &i'`k'`m'` p-L M`@P P 80$K 2K"`K! K PK K K K`Kp@ -L M D0@K 0  P h tK@-aA 0-@L `P0K0h -LM@3 `<Tp8  3 <308 S0  40 04K00 z(K 80RXRU  XP W0T ZT P 3,# $D AT0T@@@ -PLa@XP@5 OPe` "D,1p0p gf`;V3`   2v $, #( "$  @% 0-0SLVϖoP/ -LM0 #  P  K? p-L M(0`@ ?@@RP@3: K0b00 00( 0HU  DOQKp -LM K"$@0 K KK0K K -QLM@?0K#40K0K KK ,ĠK1K K K -L$M`Pgp@s` p`3`00(00,0<P p@ `$`00 P ᳛ K8K 'P5"[2RAg團 S`P&p0Se00S 40Su(gt僘p2 0h20 0P g@ 0o,s->02 00 lP g@{ 001 00 XP f@g    P fX3   PP s  00 S0  S8 S4 `00T000 `PPW @Pc080Kd070K[8890h \&A@KA؛b?aAbAdaAaAcA?*cAcA?OcAj?ucA-aAbAcAcA -LM@3p 6006S\ 3<3&  & (Ko606XbVc080 P80 . K - K"[((R  VP  h05 6PZ  ZP `3<36060 h0 08 #8& -LMP`B@4p6P@ ,P0 ,0KO0( 0 Y 06@  Cn{@ K 0-0SL]ϖo p-L MP`e@hP  c00Kd00K1[88d0h0Kph p-@LMP`T D00K00K1[R !<0dAbA -PQL@`RRPáR Rx c0d dP R L0R ( QB̿?cA7F -L M@pPnS   (Koi\ 3<3 ]}  D 8XbV 0 00 SP00 00 j P  00 @PS `0P3<3C Y :  0C  (Ko=+ (K&* -PpLD@;P@Cn b,100 !S`V  3  3   9XL [@  &/. D00-0SL @ e0ϖoP/ -LM0 $  P  K? -LM@`0 pPTH0 % V&(K0@ PD0U40#0 F@R0D"0#0"`B `3 !@!0 VP:& V0 $00400#0P  @@V::P  00 0 Q0  Q0`F@D@ ` -LMH@@p(P` 0` 0S8@#82K02K+Q@@x0(0 00C0CUPV  ,KL0( 0T  (KK $K -LMp@P`P @0?0$0K0#@K"`K PKFdETDF $K !`KPK@K0KK p-L MP`@P90 H6@, T@  "@@ @0AOCO S- ( "(R R R 0 T@T 8KphT @ @LKpLdA -pLMP@ 0 0 >;5H0:H0H08  "KK,0 Ġ0K  0K 0"K0(̌0 ̌ 0 Ѐ 0(Ġ  0 00(̌0 ̌ 0KH0 0 !0!;H00 9>  9>># 0 0 E@$K0 tT0 LU0 LV0 Ek05H0:{aU.*a 0-@LP㭋K0h -L$M`@W000 P) IP   0Ao̠L̠/ 0^00 \P 4P40 Q  R80@X0?SW0?S00<0<0s0<0H0@p p0 p@0K0 0P04K0p 바[;Y p 0)W񟗭$$|$$$$$$$$$$$$$R_ ,{, 0 Q9,P9  10s Q1P(  0b Q)A P 10 XQ QOVQ00/2O0Q00/2O0Q00/C1O0y0 0$嘉 Q(]CO Y 0L Q(NCO 0  Q(ACO p0 p H0 p 0 tp  0p D@000 P $ C?iO0 C?cO0 C?]O0긇R0 00  pQKOQ00/2?O0@w0<0  Q,0O= <0w Q$O,  0f QAO <0 Q00/2N0Q00/2N0Q00/C1N0Q00/2N0R 0 0 3K) QYN 3[x 00 QPN 3[0 0 QGAN 3[ 00 Q>N W<0 O <0J>0K< p3[< 0?0 <:Q00/2rN0Q00/2iN0Q00/C1`N0Q00/2WN0B 0 p( ]<0pS+0 l  Q0 p< HH0 p ?0p y(0p s 0000 h  %pH0  0 |[p2 pQ N"Q00/2M0$t 0 <1 pQTM>K0 )Pcp3[ᬡB050 hP f03K3[pW0H#40H00 H0 0% 150V0KH0 0`2H0 0  @ <0K< eQ00/2M0T  P t ?@KAb?aAdaAdA dAbA  |bVUUU"`dA`dA U0dAP/ -LM0   xP  K? -LM@Pp`x U 0l!l&$K000?0 !$H0I$I@DH$H0D8#8 S 0S) 00 P2" P$ PS A `10@ Q0@  0*   T0 @0S8#8PU`S B S @ ?dAeA+eA -p`L M-0(P0CU,@Q00@  Uʸ!U00SQu @u3@t@.0|!|f>4@2K0T@3 S!uH7 0 42K"[4"48#8 S2K0 !S  S,0 <. 0S%00000'$ '(  p '|$($L p@0 0D K(0K < &0K'P 00&0K ?IeA݆ p-LM`P@P$4'0K$8&0Kl0(@K( K$0 %40K0$L$K 1K%@K PK傿0P @0 Kp@-?heA p-LM`P@P`0( K$K$0 %40K0 (@ PK1K[P( `0 ḋKp;?heA 0-@LVP^P0,00S00  R= 080#8S(!3 1CP0H0 0 0S00  R= 080#80C?o2S) *m+f00V tP P RH0. 0 0SD  S< N CK0hHu+H@ -@LH0``PPpn`Ѐl00U+  0** $Kk" 0-L@APGA A@@ ?04 A( A3A K0h? -Pp`OL  0   H@T -LMHP@Pp` P&0`00 1 @P NJ@0A 0B 0C 0D 0E 0 ?@KAbeAeAfAeA fA?|eA:fAeA'fAeAeAUfAjfAvfAP/ -LM0  |P  K? p-`L M@P0  '@PGKp Č \PE\0 &@PF L(00"( 0-P0( 0CLR@0( ;R< b=< B4 000 0-@L`PhP0,0000  R= 080#80S0S0K0h; -LMK͠K KK 0K( K -LM = K KK1K K K K K K -LMKK KK 0K K -L$MP4P[ 0-@LgPP0    _ yPUuK0h' -LM@Pp`:T@ @  0 `K K &d `K    K -LMP@p`UP @   {  0 K   [ 0[40K -LM@p`PH0 W  O  $K3  B < 3<38  t0 (0 ,0 0, K%0K0 WXRU  BP 2r=$ K> SXCP!3<3 <0, K ( p-L M@Pg`umP qPKp3@  , 0$K+<0$ K  0   3 1  C     !VPPtP PPP 400-0SL@)0ϖo -@ p  L`APCQR  U10 0 -L`@0p\:X 嬃P PU0 Kh\ PU(TA -PLp1P^:p 剃 \ ^0 $Kk  \*X5TA/ -@`pP@0M 600L(NB @  0Kd6c 0-PP0L @0@86B0P l1  0K0h50d6c -Pp0p 60`LM`P@B0P l1 0@ 00 00QKd6c -p0 60LM@`PA|0T  Z 0P 0 0 (K0 00 :/pd6cvd 0-@(,0L(!60AK0hSd6c -`@Pp@0M 00L(A00 0ᔑKd6c -Php 0X0LM@H`A0P l1 00 0|Kd6c -L(0M 0 0  o KP%T% -00ML06 0 0] KP%T% 0-L@tP |1R00 0-@0(L@!60((DA$hK0h`d6c -L@P`QP^ 0 Kh/ -LAP Kh膜 p-L MP`6PAT 0` 4/@P zKpvdfA -L p-LM`P1@S@ PKx!? `0  r>VPTThះ,Ko|bfA ?@? 0-@L]P1!0CSP1 l1  0l1Q_"K0h褏K0h0S$000S0S0 =;=//0S0 =;Ó=//Q9 *R4P-09/ 00-L@M000,00(0\0 0T0@00P0<$  0A0K P eK0fA@?gA -@P= LS80  `p#8`7/= S8`p#88  7/p-=R8  08/  pW0 t79<=t=S$z  M0 ,9=m]衆*gAGgA -@p`PL-=R` 0 09/t=S+`yV-=R0P  5/x0PV0 `<= Sh 4 ``06/ 0 ؁蠆ggAgA000 Γ0\SG&$ = -@"\JL2p022!S S22`022S'`P 20CS2f`0 b 0-@"\L 20CS22MK0h -@`pLMP|P_P000 =S=S=p=PSl 6 0:/=0 0==   P (K = S6 l `0:/= S6 l 0`:/-9- =R006 l 3/ P D - R006 l 3/ 0P4xVgA -LM@PT` =S=S=@O@p=@@Sl 06 7/=@MKP ->  0> =`Sh 04 / \ `P/0 !`8 00 (  , !/ b$cDcHc -@`p}_L= 08/  t=SxPU噀<= S8  `P#85/= S  `P05/= S  `P05/ 8 `P#85/gA 0-]Lp1-@P X]> S.<<N}=0=0>030 gA?hA 0!< 0`4 0 (   !/ b$cDcHc 0-t=L@S0T>P0C>=0CS=>3;3K0h ->L@S`p OPPVt=SP 0w >PS蠆 -LM@ !PpP` `(0KP "[R- 2[T  \ K0 B R  , 0 hAEhA -@L M0K@#PPK 0-LMP@p=S 0 5 0000:S=000 KPx=[S Q  ZW0 :S|+%+%+%x+%+%+%+%+%+%Q  Q K0  D -L4M0@pPQ+%4,%4,%4,%L,%t7S 2+`7<`7=0=d= 3/x(K=hhX K0=0r XK4 XK40Z K|e5[!6&R!J%[H|1?001t7GS/( 40Vq 4>0?0?`70?t7S 0  0 *t7S H/oh"P K"0`P0[NK S 00 c40Vq Z4BzhA|b1%A -MLM`A^K PE@p0#ExP0U0C0S$4 K S;U$4 2Qu 5'0CQz  QJ  Q~ p=S#2Q #0CQ 0Q7-$0S$4 0?00P2Q& 0Qp=S; =8 0E sP#2Q >0CQp=/ !QS = N0 ?;A0CS T{Tp 3$4SS$t $$E /  ("( E N000$4 S = Np=S = N0p=S =N0 :S >S$f$4Sb* L  S 50C2#110L 1 0 $4 3H0Q 0QN0 N0N0-*  0-L@P T ȓ :S :S 40  0 )K0hp!%|b1% -p`@P㰠LM000 00U  200T(K0S # 40 8 8  z40UP00@@hA -@L`p=SH4p 3/>S.t]U= S`0d 2 9/> FP=0.:^^8X X3XR=3 \=3/p]$KkR -P0?L0M0p2K(0K `@KPU 0 KP0 P! -LM K l0 K -@L`0pPh=3/`7W) 5`729#9 Kh@ p-L Mx-0PR0CS@t 0@ӕn R 3 0HHy <@KphS @0.@ӕKp??hA -`=L@S 3/`pt]U't PP `V||= Sd 2 ``06/= S``h 4 (06/ uP N_A - SL(MP`p@7 >K1 >KDK 2"0@ K.K -L@M3@@ > Ex=S S6P$)"" 8PP> 1PP@ dK{1^b0Kn U C1@PV0@0d KP3@ > U=;=$K)A S- 1R > P=x=  S :S PPn PP`0 S 3` Q (<S3 #|`h~0 PP` V@p ( !*(#?$00- /h'/p-R/t-R/M -LdMS@\ 3` <3K0`0 Kf K巼`bV p 7PUK  #1WP `pPۼ 3<3 -AMLMBnK `F0F@t$84 5PP84VT$pAW7 +$ BWn  Wp=  W p=S yz#W(  W30 S  \ RP`p=S`  -0U#WPQ )3W 0W\3WS=D p=Sq`F0@#S0N09 V# BS0N02  S0N0,  BS0N0&"W  W2P0 0G. P 0SPE 00  J0 (K0 P P2W= 1W=1W= !S0N0  S0N0 V BS0N00 jP S :S x=S S S@!}0>031 F44 0JP 0 F0F0S2P 9S#PÚ 0P P P9S9  090 $PP ;p=S} > ;S0Tӥa|%F*-? -LlM@`p=S t=S?< hKx0 h/=t0 =S >S3;3(K9S7 YU 0S990090C9:0K 902K p 0 P <5 0 03/05K :S@.05K @ 6  xVPU'W ?:SP8U PU 0S000000C0&&:0K (P (4 0 03/x僊pP'2 0 x嚝nv x寔PPd5["05K *(0R  -   |0 p ˔ G|0  ᠣD :S㇍ P0S p P  0!:b(+010 0#4 001 0 $ 0#4 0h2008/>p0 p (00D100 0<00B$"C1 :_ KS* 101]0Kt 0>p0p(0."(0%d?hA -LdMp=@S QDP 3@  = S4 h `P<5/(K 0|0 -=R0 ` 0P5/  -=R @ 0P5/<00l0K [P 0l+ldx& -=PR" D 0`6/=-0C==0=1  % q-= R$ H 0P5/00Pd0K P+ 0*|(x=0.m3;3% I-= R$ H 0P5/<0 0Pl0K PB 0)x=0.E3;3 -=R  0P5/`t0K `7[\)S  S = S>`P4 8h #85/> 3  =0S Pt0>|00S|0 (X i0>= S`P02 d 6[ :S=6[&[d[80 T8V :S2`e[PP+ pW0N  ^K -0< 0`jp(p3p20@@00x P$ d[gʄaI8e0[N8f0[O8+010 0#4 0010 0#4 06[ H80H8(7 0 $`06/0 *o00R0S  '3P 3 #*88S00C88\p[&Rvp0 0 06_WHH tx 8 (P 0,ᤡc0[ Sx0 %Px`(xF&H(l`Qp  !p0xPE%>Yc0[T%tv > -HX %Dv >0= ᙈ0xPE%>>nc0[ S$V[EPp vW s s s 8Kd[޻ s0S ss'c0[`PE%W\x0 P xpH(Q 0,L6p0x`F&>Yc0[#ovt > -HXp#bv >0= ,0x`F&>>^[x#Sm Su0 0l0K96[_0CSh P%P%0P%hP%XP%P%=0=:S :SYc `H43/O=0=Kx=S >Sڤ" P? 0>< :S9=0@ :`SH4 W[`PEUP#4~ U .>0/000000l0K6[` 06K&[0000x-W[p0 R RL RF2pI p0K >p`fP: > lK+>W01>0#^Px0 Yx0 0l0K6[ 0fKEL+6[06[ZK`0&[LP0CX T05[,06[(03[$05[ S 0P0P 3+xutDp`?hA??d?iAiA0iALiAbchiAriAiAiAiAiA@iA -LM@ppX\=3/PP0p= @Urox=婒S 00S989=0= :S ?989x-R9 L;Sڦ_ n> `L; J("( L;x,1m 0*0 H:  )0% n  =  = =ۮ  =  ;S0ӥ= x; :S x=S> P Dx=S ~G QW ;# :S 3   x: ; 000======x=SY Sh3h3ݞ =>080 ح  SP& 0^t P$Zt ! x=S ?> 9 &0 0C0S000ӕ ꤢ- R000 ` 3/-#lZh(t0>9pk<0.R 3;@030 *:R1323= S``2 d 06/X  :S xQ   :S P(KojA  -%3?2D 1jA@jA8 ]jA?I -LP`M4P@pMT  @: 00-@2Lp=PS0>S 0CS>02 xYp'K0h>S 0CS>x=S, 9>S02K0hkIjA -LMPp`>P@ bn@P $K 2V0CVl*1Vv 1V< 9P-09 s94P@4P=Dp=SH 1VJ 17V1 @`0;u@P- ~4P@&3@* x2(1V* 0V +' @P#p= S :S    +5S@?0.C@ ᒹ4P@3@ x=S@2iii8i( b7i -L,M@ LPX < o,"\ ᜳ>=w=p S2 d `P05/= S4 h `P85/0t=P0t=n_m0 P pE.PX[  'ሷ<Bo0`,K0(0@ K @` <` R=2oxm4[gQ RB'o0x=x=S4[S:o0x=x=S 0@0 <0 0@ KD0 0)d3[[p ##[0|=0`D0 @ K0L@` <` d 3[[(!##[0x-=R1  'SS, 08 KD0 08` 4` 0` P 80[@S60[.S30[-S00[S05 [x=70[0B00C)*d 40[00Cⓩ)20[0C⒑#1 [0 B0=]=x=S<& 8S4& 0nx=S |mddzv 0 n뀝d  P df bP0 n$=  $' *+`5*,0T5`@0H5bD0@508504530::> 0 P q:4K㠠H,0K10S S2 ?00;AG MᴠX0F KP4[,K SBQQr  `RQ"1?0;;S4 x=ڎS0 =  0F KmP4[ d00= -x-R, R RA -#Qb?Ӕ= ڨ#Qژ0=3*Q8<: :<:> 'hmX }0X=_ `@m0/-,-Rj>0=3R:8<: :<:>  :<(0F KP4[S:0: 08 K@0 @0KPn@0Skڸ[y6KY M&~X2 =P2=徐ᇍ>Ⱀ`PUGc8H4"d=T4h=1H41 ;1$;1T410=14=18=1<=I@`1X 0>8/a= %1`D8b= %0`8lhH (K2R:;:yH0-=(1R: <:>Q GpQ BpJXF%jAd?jA kA,?J}AkA' v'N$jAjAFQAW2>PpN3<3 -LMpPBb?sp?pp (09/43"0\9/ 0(8/63\p(#H07/\p0#7/\p0#7/53\p # 07/0\p$#7/03S \p0#7/6\p0"7/\p0"7/?<0 \p0"7/\p0,#7/\p0 #7/pp(0 8/43"A0\8/p(p0 7/p<1\ 00!0"p8/Wp4K %1>80 80 \p8  0 !$xJH0XK@=00 K<P1\ h00 P0 0040 0P )P P (P P06P0 0p1i0H10L10T1R9ܞ0000 00101  `0 `P0 0 3/`PJ 0@G0SDA⮞wd4cnnAndЕc+b -P0L#0?$1@S#)P 1S nሞU1 10  10101 1 101`d4c -LM$1@S (P 1pSX 010P耔(080 000 3 40 BR0000 S <2"0  `@`00PS40 0PEX. P^+00`H`V!:1 1`d01 10 11S !0C  !S 1ԕ 0 1ĕ\` 16/1 101B1S aQ51P 0003/1 01 010,03/1SJ 010  $0 0x0A0,0(Ko/00P`FSPV   0000 S <0 0  _ 803/p10101f0 P`R4  PE^`(Kb|b% -LM$1@S(K(P  w`0 d,P5/1P SPV`0 d,`6/` 1 \Pd5/`0 d,P5/P1 S`0S]`0 d,`6/` \`0 d6/` 1 \`0d6/`1x \`d6/`1| \`d6/` 1 \`d6/`0\` d6/e`0 d,p7/ `V`0 d,p`7/`0p, d8/ 08[`0\` d6/`0 d,`6/0p줟耔00 ` d,03/` 0S  "QP$l0p00 Q04S0l0 l01S`` 14T PU`0p d,P5/`0 d,P5/P0S`0 d,P5/  1S 0 1/P`U 0t dUP!Pl`06/00C00PP`0 d,P5/P ᷜ PUN[ ᬜ 1\` d06/`1x \`d6/`1| \`d6/` 1 \`d6/\`p d,03/`0S  "QP l0p 00++\04S l000pHSp0l0` d,03/` Xp耄10110X*101X1011S 0CS 10 10` 1 1\P d5/`0 d,P5/QT1`P%P  ޛ>40 40 1 1PQ 1000001 1 1 d0 1\P 15/1S01010'UoAvcЕcoAnd 0-L@4K0hg -L`p@Z$!0S !t@S0C0i0@ ,P5/Y0 ,P5/0P,$ 9/t00S "SRP0l p  ! P$Rl  l /bЕcvc Еc -LMP0@`0 p0 7/pP pU0\H 9/ `0v UO`8 #88/ 0\8 9/0\< 8/U0\P( ) \0( 8/UP\PC0< 5/0\P4 5//0\P, 5/0\P< 5/ V00H \P5/0\P 5/,\0ES8 08/0\0 8/8 \08/0 \8/F40\ 8/U\` @06/$K -`pLMh@P\ P0 CP 404 l >(>`dp\`hP $KЕcvcНboA -@0P`L M|&0K%PKX %p& K`u% KXq4` 0 J01@0` 1 1\P d5/V`P%0[ h Q S'  S  \ `60S h0\0P lU1 0CSh LP&0[S0@0000010CSf%%d%8%%T%p%%000U00 P Y0  00$Y=5uA|15P151 ' 0P0lX$K000PU00@0008U00000 U00000` 00\P0d5/T000` 00\P0d5/T0`0 \P0d5/dsP`0 d,P5/P`T`0 d,P5/P %! 0-L@0\0 !@Q0@000 -Lp@P0S 0S 0a@P  Pn@ 0-LP@K0h -0L`@hPP 0 \00,,@ 4/3"P 0 0 0 0h0 03/P 00 0 0-P@L"0,K0hq -LM@P1Tp #3 #300 0 "00S 0 S0 (Ko0 `P`(K @L` X 0 P  0 '@00T@|bMbmrA -LM@lhpP%`PP(K\0u"P"p,4,$0 $4!YT:@<0 R80S@p<0$Rth";G80S0s0SY"<00  T"<0S( 0/KP C"0L# >" 0</KP 0"<00 Rp  P  &"`80S<0Qt0S 3/0\p $7/ F ,0,3/p<00St0S 3/0\ $8/ F ,0,3/<0 R@ 8 Rk4Sh@f0! Wt0S 3/_020\ $8/ FX0\ 8/0\ 8/ ,03/XP<0p00 ,03/P@ #>K00p<0pm \0(0K0`0p  80 SU<0Q 1!0 |b Mb}rAurA' -LM@\ pPh088!, <08 RR<@<0 #`30@`S00I! 0 _ 8080$2\ 0 p*Y 0%!(K/ Y40*p x0S 3/#00 3<<0p 7/3@0300 #,##*0 # m##  <0 @ĐD \0K0h/ 0-L0@4D ,@4/0 -LM00 媗 Kd? 0-0ML20*^@2t0t 2l02h0e0000 '2S " g"K0h蚗h%% k%%(k% *ᑖ *-LⳖP 0-@PL*˖20200*⢖*Ӗ//// -@QLP` uT 000D 0@RQ@ AQ 0Q0  Q  0/ -L$M5 4208@0 p`I90 D*P xP3 204#$44#8#8S S S S S@P"S  S @H"S  S"S< $S "S 0A S "ST/ 2Y @ YU  Yx  YT@#0 SLHH<"Sn  STs@ S "S(T(@# T%0Z0 09/P0(0o,y孊(K Y# ʀ1Y|!23 Y  Y0S*T*@#D 0ST@#( T@#S 0S T @# 0ST@# HK0 G0KHK@ T 00@T00Ņ@Z_$CZ%ƕZ???? ;?rA?????k@ -@0L0`,yP/U0Kh 0`( "4`#/ p-L M0@PX0\(``2 6/X2 4\0Kph/0?0/ H00$(/0-#20!Ē<0(\Ē(,, 000$(/L 0 Q00//0 0L00S00݆ 0-#L@R 3S00LΆ0 TK0hdž -L,MpL< S0L 0H PD L㮆 8S7X2YTr8 040 0@H00 Z/ 8Sb0YL0 DH[Q$0 ㄆ804000p 0k@0@(Kx1Yt! 8 04 0<S0PQ0040 E00P <0C@0 >P0. R< *R9 jD&jjf@0`F<(P08  (R00 8SU  8S03Pc0p00Z000 ~ $0 @u ` p-@ ML_Ẉ3X\@0300(``2 6/X@0d` \6/Kph -L0M@`t^pR pPt  T @$"Ġ$("(R  AR AR p3tR lRU.0 R HRWp0R RU 8UWx 40 8 0p$P$pK8UP@QP &$ & & & & & &X & & & & & & & & & & &T&&0X0`2(` \6/0Xd` \6/0X0`2(` \6/X0d`0X0`2(` \6/X 0-0L  ^>@P &0t@p00x00|00X&& -LMH0`@t8S gP= 0XLp0Ҡ᪯8 8 0P0P0000K0 0[PP 0 000$0d 0 Q000 0 Q000 8S0 3$03P0 0   8S (PR%)0  00 0܃X(Pʆ(K -H0L`@t8S =RUwU$hⴆ -`LMfXUᣆ$0K [@P!X P$ 0P$KP$04@(,0 0`@ T008 0XX 08偆 ]0 0@0K -`LM-XUj$0K "@P! P$ 0P$KPJ$0$@0 0@@ T 080XX08H $0000K -`LMXU1$0K @P  P$ 0P$KP$0 @0 00@ T080XX08 00K -@_L`ἅ80hKh -0L@L0TpPX 0 ` (0 R%)00 0 8SP /{ 1|P 0S0  0 0  00ł R P0( 8L0( 80s00aR1x Ax0(0t -LMH0P@t8S `= 0YL0Ҡ᪯8 A8 0Pp0P00p00K0p 0P` P0 000$0udp 0 Q000 0 Q000 8S+0 3`03$0TWE` 0 L 8S (0R)%00 0 :0X0`2(` \6/X d`0\6/$ R =2S`0`R0l 0'!,0 #à108 }`Y(`(Kp|bMb& -L$MH0P@t8S =2880 20<0 904@0 80S⟄0PpP0pL0`PD0 @0S4 000K0<0@ 0 8S00$` ʁ<0@ 00L (0R$ 000 (0R$ 00 0$孁T0 X02T0 ᠁ h"h2Q00 8Sx_ 8SY 8SRP0 400Podp0 $v<0 (<RCPP0R pBV@L`&P0SuPP 0Q0@嶓p᠂0U:݂& 01S (P 80HX 000? H00000 X ? -H0P`@0p@@BX0AL#6T@1@&@U:PAᙏU@D 0@p崄P0H8 0PEℂ(0S, , ,0( / -H0QLPp`L@   0 hm(0S(pt8SHp 0 f (0 R)%00 0Z0/4x 8dS00S( Y 8S  0 4 0 / (0 R)%00 0#,Kop0S  0-PH0L@O῁K0h|80S< < <08 / -(0LP0S $Kk{=H 0p ( L@  0 ~ (0 R%)00 0~/d`w@0S =p 8(S (0R%)00 0 $Kk~ `rA -LM@ 0'n ~ 8xSppmpP`P0 ~X``2( \8/X0d \8/3X 03`(``2\6/X0d` \6/WUX(K'1?0Yf  W ((0W 8`V <0`pV/ (0S,0hZl0S 8S  A A3 8S) Y 3(2P P00S L 8S 0 ~0X0`2(P \5/X0dP \5/ Y0 Y0 0(0^o@P$0U00 a (0S^g0hk4U @X00C`X00d00( 8 S7 >00S 0 |(0G|W$(0S! 8S  8< S000.448#8C^0:#: P0`4 0#>W(0S0d0n0 0 $}P 8SpDp` P 0 4,n}$ 8Sp3prA -`p0L@L0PW 0T   0 O}0  0 0  00E}?v 8S 0L0( 8p 0-P0L0@P0( 80 0-P0L0@P0( 80 0-P0L0@P0( 80 -@Pp `L 0 |0 0 0 0 0|P0S 0   Kh| -L M0P00 0@thV ` $00  S4 0S S 4H0`$H `(KppP`  ZLpTP`P0(S" 04 3=00  (R @\ʠ$ 0] 8S00:SR 8SL0 y|Z Z) Z 2 H0T0|`P*_ $YSP P\ʠ$ 0S 2H0@0s0LS :`Y _~80(Q`A p W 0  Y0S0!`1 ?00 ~1|r 0 0  0| 0 0 0| 8S 0  {~ 001x YxTX`!`0`H000@0T0X`~ #LoD0H0_}~ $ ~?d???rA?? p-L M @PPKp0X0 (``2\6/X 1 d`\6/3P  08008nP 0(:008P Nj  : :0X0 (``2\6/X0d` \6/@ l対0X0 (``2\6/X0d` \6/3PSUsAsA2sA -PH0L@O},m`/~V0Kh -PH0L@O}m`~V0Kh -PH0L@O}l`~V0Kh -PH0L@O}l`}V0Kh/ 0-@L 30330_}T x2S K0h} -L$MpH0@Oy}l}H0`L040 ?@0 l}t8S @}(KT0s (x2RvT0P@0LP00@z :^#:00 @08 PD0 d@< D0<SmP  ]0 0@0,04z 8,#JST0 02C 8S= 8(S700 8@S/04(0 #20@p!=0Q881<F4<0,0 JzT0D 4 X0T0X000 00(040 @ 07z 8(S404 (0R)%04 0 0 "zh<0<Z0000H0  H800>0SFT0L0 0 0J 8S 8S 8(S00 8@S04(0 #20@p!=08Q81<F4<0 0,yT0 @ T0 80PL ^P00 998Q#8#48#80<00<0 H000 -H0P@2XL$`P P pP 0X`p0P0  yPP @|80x}|8|80hu| P 0-@LT0t8-0 -L0p8 0-@pLP!]lP₻||x2S I30nP 0'y -L,M@P$;! xR { {  +40 xPPxrp2,t2x[03P (0R)%00P (0R)%000  xvP (0R)%000  xbPQ_U P4Tx0x25 (0R)%U000E031|20 (RL 0 Pyx?U徯_0 8S:x2 U,04dx34<P80 -H< ) 0 W ,81S0X0 (`2\8/X1d \8/0X0 (`2\8/X0 d\8/d  #qXPX`2( \9/X1d \9/\9X (`2\8/X80 dP\5/dpPXP`2( \8/X80 d\8/dpXP`2(P \5/X0dP \5/ ]1P X]9 WP P P PpXp (`2\8/X24d\w 0 8/Xp (`2\8/X4 d0\8/Xp (`2\8/X4( d0\8/Xp (`2\8/X2 d\8/H80㿀Xp (`2\9/X d0\9/<04/(NC @C Xp (`2\:/X 0d4 \:/Xp (p`2\7/ XR0dp@ \7/8004<:00 PXP`2(p \7/X00H dp:\7/XP`2(p \7/X8P dp\7/pXP`2(P \5/X00H dP\5/0 P88S oHPU0P 0\000X0,X(X(``2 \6/X3 d`1\6/oA&osA^sAxsAsA#?sAsA@D? p-L MP@XP`2(`\ 6/X\T0d` 6/XP`2(P\ 5/X0dP \5/Kp@ -LM@Po@y=20=2}yXP (p`2\7/X2'dp\_v 0 7/XP`2(p \7/X4 dp0\7/XP`2(p \7/X4( dp0\7/,8S XP`2(P \5/X,(1dP\0 5/(XUPX`2(p\ 7/X@0 dp\7/p$oX`2(\ 8/XP 0d\8/2o0,8(8x=20C=2x$K -LMW@_x=20=2x(8`S(h,0X0`2(p\ 7/X0 dp\7/2nx=20C=2xK -LM@P owxtXU @x$KP =2S 0X0 (p`2\7/X2 dp\x 0 7/x2S @P/ 0@- \R@ 0^   -L M@`0N. 0 Z5 Kh3sAtA -LMPQ, p@T)P P` [/p0p 4d0( KY@P(0H p004 s/$K@=tAAtA@dTtA@J}A/0p@-0010 S0oP @\@00A#VQ@pp@-P0RpA aa A@@A`@$@00@- @Q00 00Q Q00@-R             (0 ! P " ( ",( ",( ",( "  "  " " 00R      .<!P " ( ",( ",( ",( "  "  "  "$ c 0 " "  R     J0 !\ "( " ( " ( " ( "  "$  " (  ", $ ""CO@((@ 0L@."LA(P@A( T  "   "  "   000x? 0-@L A2 D\0Cs 2 Ÿ^0 !LPAQ(@(PAQ(X(D@$!W_!P(P(Q(\@$!!LPAQ(@(PAQ(X(D@$!W_!P(P(Q(\@$!!LPAQ(@(PAQ(X(D@$!W_!P(P(Q(\@$! !LPAQ(@(PAQ(X(D@$!W_!P(P(Q(\@$! PP P PPPPPtx?p?G-`P `& p@ l&8M h& d& ( ( ( ( p' |' x' t' @$ L$  H$D$   $&̠ (̠'. .( Л.'0.., ,'pq,$0w,( ! !$ $LГAK !&&go@$`pc 0@$ p@$0` ! p,|@$p!wp$sp!| p$w$p.s,(pp ,à4!c\`,`$L.a  $q ($(,,04O= `g !c! !0`Ї`&pw@0@!((0(!pp' p'$0p'(, ! !0  !@$4 `( ( ,  ( "(   """ " ( ( p,  ( " @(  """ "$ ( ( ,  ( " (  """ " , ( (, 0 "(@(( "" " " 8Ѝp?x?G-P` @P% p \%8MX%T%`&l&h&d&p'|' x' t'     $%̠ ((Ĝ',(, (,',& ((Ȝ'w,p,%(, ,( .(.&(&co.%PQ(X`P%Џ (\ p. _p,| p)wp spp g p,w `..c$p.)s(p0p `,4)\ $^ (  ,` ,à$4Qa(0 , q0> `P((T P%(hP% p(x( (P% (ȜP%( ``&( `&`&( pp'( p' p'$(, , (̞ 0  .0`0 P 00ĕ  ̠ Ƞ Ġ 00  0 p 0Ě  ̠ Ƞ Ġ 00 0 0Ę  ̠ Ƞ Ġ 0 0( 0 !,$ 00$(  "" " " 8Ѝx?p?-0 SR0 ,@SR,@SR,@SRS,@0 @0 R03S0x0#00/ -L$MPPp@$ Q!@  TRT``S@a  r DKnWP DKRL DK M KA0  CR-LQ0  Q -oPpLMP`@s Rp VSS00CSgb&c&c&Lc&rPV(K0 L `@ PrT <KZ0< KL ` @P V  <KI<0K L x <K@Y`@2@0 @0T  <0K L _<0[!0 03"10  #P C 0 S2 0Y00@` -oPL$MQ@@0 P0S @0RS&C2D0 0S S) `D0Pp 0H0 H0LT@0 `b<K<0Kf 2 0< KD0(K0 @` D0P<`Kr0H0 H0U@0@0aS !0SH0 L 0 L  P 0 QP-LM@Pp|  R Qv TS c0BSmf&f&g&Pg&rPT(K0 L @PP TP <0K L <K Z  <KE @P T  <KH<0K L  <K?X@P2@0 @0T  <0KL ^0  #Q C 1  S2 000<0[ 121#1YP@ -oPpLMP@` R TS (KC0S S% PJPpUL05/cv^ 0ho00`0S PZ 0 p200p W` 0S2001n8^0 Sd0001c00fF8i0S00d0Q00@Sg/1!t11*7L`01 RA 1ES  s00aR310@0o11S01(K16 "6&0- R    R    R   "-" R   .R 0  S0@00p8Sph0 S,%01 dHvA?bbcd}&yvA0.R  "-" R   vP/P/////-R&&& &&& &0\ 4^  8P p7S0S? -L Mp@崠`v>0S4 0!&(P㌀1Sʀ(@T`(K01 00 P 00< 400U (PAAbvAoA@vAvA -L`@PP8!8Kh10000x7vnS00tq 20zt7S S S0< 00CS8&H&T&`&l&x&t7Sh8D!0 0<00;0800808070B;0;?vA -LLMpP0`p0 r@0 p!M@ ht dKhP v>0S71 3a0 ith7  0 ath7  0  Yth7  0 Pth7 0 HtW 4P4t8St7tX4S d0tg6 V tMaN4 R`78`7`784?vAJ0000 000/ -LMh1P c1 R S00*0 0S0:1D!0CR @0@0D10D1! !0 0 0 000 R000 0Kn\0D1S 0S00 000 S D10CD1! !0( 0 0d 0  vA wA΀\Q:  / AA//// p-L$M@8PQ"1 00#!" 0 0000( `0V :3/P 1 0t | 10 18003/@ AH08003/0<0000Kp;wA|?FwAywA? -@pt0t`L:l0^`婎8`9/0<pp0@PU,0:(0:$0: 0::?c& &&&0S 00!, QQ !/?wAcwA0S <<!8 \ \ R !!/?wAcwAP0//Ḗc -QLM@p`P ڐ1 0|"| $10$1 (K\XQ1I(10(1,"1h1 0O c m/X  h7岐`71 0!P `W h71 !C `80S0S% `03/P1 0,!D- 벐,10,1W1 1 1h000 8003/8< 0`R*.0K0 K9/P 120!S 0! 0`  W㲐`0`4!S 4!q 0$ P k3[02[0e?xAc|?xAoxAxAxA@FxAxA5yA 0-@PL:3/P:3/0 0-@L:3/yvsp:K0h/ -L,M8`@VPpA!1 ᴐᲠh0 0#!"!0 03/P1 0 000000{ 101(K \0R 1 < Dj 101 :(Ko/;wATyA?yAyA -L Mp@`` 1RPnP1U`S^1 oh0 0tt16 000PK08` R@@  0 RppS0ppp 3SH0L RP00H0 00@Q&@0 00T 0(0 0(00S*ހ@P  # 0 3/P  K 㤀@?yA?'?zA -LMPp(0`S@!R!  %0K |0 0R@%@[@N@80S*ᔀPU@ 00 0$K (0  S*!R ( ($0 3/P@9?,zA?/0-@S0, -L MPY 40 0`  @00 p40  0#$)< 0)8 0)4 0*4 00 p00080000000S/ 00S0000000     x00000 0(Kom00S0000000010 -LM0<S !"  8 4 K0  -zAP?<YY 0-@L{2YP0@000\? -LM<00`0 \xx_0c \@@S@@@00  !# 3  4  4 "$ 0I Pp<\K@ 101(#|K LKIK `0`@CY @I`00 T0F0 &ʔ0SPU6T  |K| KG4l KK~0K}pK lK \K|K| K f,(K |K| KG4l KK~0K}pK lK@DpT`@9 `0S 1 # R  B|K\ , |K| KxG4l KK~0K}pKq lK0S1#Y IlK R` ~0@p0C0 ` @Dx 0 r `0V0C0 g P0@U0C?zA -LMP<0  0 0 0@1 e 0 000(K`0840< t0K" SR : 0 0 M+0 00000 p` |K1010( 0 0@4c8<0l0K 0L0K00K0*K(\0K Az \K0P 夀 00 0@CZ @100 CX 9 0$` 00S0 CX F4| KK~0K}`K |K lKl K lK\K!Pe 0@1 0 de .0 000cI$~ KK 0 }Kz  lKl KnH00X00 0@ Z 010#S@CT @0 0 00 oF$~ KK }`KG  d lKal K< Y0`J000 00@Cg 8z5z*K"zA {AzA////< 000/< 000/ 0-<@L1 P d0 #30000@{A 0-<@LP1 d%3 0000c{A, 40!44  /? -@`0#800pL40040040P 0縀P 0  04 0  04 0  04 0  04 `V㸀 -L M@P@0`0ᴠ00 帠ᶀẀpp  ("( 4  H$H@ 008#8000  x*Ḡ q(Ẁ jx'xp c4 00  " @H$H@ @$'@08#( '8 *807᪨ (8ᨈჇpx0'8xw0)400  000 (K0 $ / 04 8 / -LBMI_K \@ p`$K`@@a^ ` \qNPPN LaS10C^QS  $@K pAW$KXGAHqW@@$pK@ATp@$@@$@AB"$$P "(!K'K"",&K%!KJOK$ K !Q$Ka^aA!NQ $K !R "Q0S$K?{A -LAMPKoK \@ p@,K^  \qN`` @S 10C RQ S! p @'@AB,K,$,@KAXYHAIX@@,K@ATp'p` ,40,8,̠0 EP,0K1Q,KA\AA1LQ00,K01S0#U0(K{A? -LM0S < !"  ( $  K 0#zA@ -LM 0<@` pP1 b4  000(K` 1 b1 k 10 1 0840 < 0$"SR :0   ' 0000C 1010HP, 00 L0%XX2)8U$040 00S0 0 $0004 0$  0( 0C0  yP , 28U0P001 00 ;bX  000 dwawy{A@{A|A<fT 0-@LP?TP0@000@ - L 0S88r0 0S00R000@zA -LM1K=K ~0 00 S0P  L1 H! ,0KH!QL100,KQP U!A L Dd(0HL@@P0\! @D \PU*T+ p1  _0 A,KX,K YHIX,K^.ༀ.#4.0#ĠD1KCK#Ƞ#1K=K 0 00 S0P  L1 H! ,0KH!QL100,KQP U!A (@ B@DP0R !@D H! H!QPU*T+ p1  _0 A . ! ,K#4", K !XYH!IX ,K !R. 0#$D1KC!K#(#  00 00h0 Cp0l0  1S l0 0>0000h0 p0&p0(l0`' 0h0 Z &&<&&<&<&& 㐅 sP 1 `K\= =`000V dT2uhi0 x0 MP` !x0 `- P= ;  h0SJ Q1S =^ 00 0h0S;h8 x0 0P p0 4P 1 `K@\p0P4!LK:\\<P \<xZIoᩒY   P  &PPY t0000l0Gt7S0A00S00S !R 0t;000S)0 )!! H" !P\ P B^ʐ  00 0:*000101<0%h0S S SC`` d!0p 0d!p!5  0t:t*0:000&``0d` `l0 0|0 0pPitP 0d 0 06 d0`t7S0(&x& &(& & &&X 1 9)09000l03  0  5 P1 (90l9v000d`X0@0 `71 8(09_$00$0101Xh8U1 8p(08I0 00 00 0l0&l02S1 8'0@8+a0 6/ 2" 0 S.0002021 LKZ> 0pS.00C02021 LKZ> 0PQ1Sz 3/w1 LKZP1  HQ 0SH1L1 P10CP1QP1 S0 900S00000d K0Pp0 101< d0`0@000cd`00t0 0  p0 궡0 x0 t0 00SJ Xsd lV0倀0VX 0! Z  0 +P0  $P rx0S 101r0d0 o(p(0 0(00嶡t0Sd  `t0S 4`0|0Vd` p0S 80 R ,0 dp3/P 1 ,4#0D4101ddd`0S*r`Pd`   LKz0S^0S[0SX0SU0SRXOG:oK0[ 0SpH SK SHK<KV BKR00 ,0K4#t0 (0x0 x0`S:kr `Y (0 C8#<4 0#4 0Vd` 4 2y 04"S ! ( 0 `2("k000101sGnHK <K<K  4KZFanpP)r0d0 |00@S" 1 1|!01=00000101Eo00x0 CfR  Pn0 H0\00Z000CC@00R 0 Wn0t0tp pumpPq 0p0`'?o2<7 04 S1 (00(0101iA}A0}AM}AA}AAX}A~}A}A}A}A}ATA}ADA|A}A~A~AA~Ap~A~AXd~A~A~A~AAALb8A~AXAJ}A@PAmAAAAAl0%l0`10`1( AAt7pS`7 t@P0<0%'2S30600H5 y#P 20 h8P@@`  @! !b%T (T 0R7@Nq000TT 'Aq`(V(K000S@0@@00@0S R 0"42D 00 0 @W W`70 h2 LK'`fXt0 00;t7?o2S0@/ W 1 2"0'!2a40040` 1 $3$#0,3P$00$0` K0<P `0 0@00`d0 0t0`0a06/`ph10h180080t7Sw00Sr2S1$ 4$0$4D10D1q0 7/[ S `  0p$p4H10H1HqW 0SH1L100P10CP1!W'R LKW -L10L11S& 3/"PX R LKW0 P09000000 0Spp0p 000R LKW r1S 3/1S h0 06 -L$M@`P @p@q X `0S1`g` @KRW0 0H0 4@00@0 1`a "9(K,A 0-LM,0PS@oI,,0S 18  (K"W  ,K0@@iA -LM@S@`pP S S 1S p?/000R S 0St7Sx7S^ 40040DS PS S`7t7S22S1 0J S21 ?/Gr0!?L00L0 SF Sx7S40040 00CS/ 1 D00D00J S*1 4>H.Gr0!0>L00L00Sr ,SN S@ k S< h ! 0 - =P00P0ZS\ SQo1 p=-Gr0!l=TL00L00S SD > *SQ0Q0K8 1 X0S㺟)  V75[?0Q 2  MP08L0S ;!0:1`7 0 00XK00>$08V d7 Jd78d70 00XK00'$5[   mP! X KP 0P`00 0[P  h8X`'1* 3/?S`X0K M HtZ x7S 40040 0 QY-1 5%0 5dD00D0A\*1 \5p%0 X5PL00L0\ 01:2\  R 1 $4 4H00H0oS1 4$0 4#D00D0^p W 1 x$pl4 H00H0MW h R p0 Pp0 !  4 `00`03o`7r} 1 03#0 3`00`0h8V Z 0, p`V 1 XKS 0 00 00- 1 p2"0 2W C  p0 \Pp0  J`Q0P 5/1 HR  @2T"0, <2L00L0㸡qἑ lKcSp 0tF:S 0 3/P1  <1!01d000t7S0Q8 5/`7 1A 00!081Il00l0t7SQ0 5/{ZS1` l000 X A~AAހAЀAÀAAA"A:AMA`AvAAA$A9AQAAAAAAA3AOJAoA@AtAAA`AAAփAAԂA AAA@@7AZAAmAÁAՁAAJ}AALbAAyAAфAAAAIAJ}A`APAPA|AAA 0 C ! 0 0000 0X0 H R! 0C0(!0p1l000 tQp( 0  R GRZ 1 10|1!JSu ! 02! 0!18x7S ! 0\2JW W㐁C  p\2\"!0 00h8V, `PP 2 020000P ,K1" XK0R,#U0300 Q0 5/zR PP,h8V n 3#0L3f,Pf 3#0x3 P  3#03h00h0R3 XKQ( ox7S9W) W7,P 9D0,0Y 1d$ t XKQ 0 h8V<10<1h00h0 1 3/ vP  ,)Q0 5/1 pH5H%000Qx7S1 3/Z 0S! 0%5J000t7Sp xp0 `t7S&&&&&& &&&! 0@&@6%x7WS 000h8V  `P 2 02Q05/1& XK7Q  0S 2 9x7WSY 10' XKQ 0 Ph8 V<10<1h00h013/_ 1 3/X1S 7'd00d0t7SI0Q 8 5/At'Rx7S 400407 W0000 00St0 0 0IQ*1 h8T(Gr0!l8L00L0hP 1S 8(Gr0!8p00p0t0S" 00 0|0 p0 0 x0 "0 CR*1 L98)Gr0!P9L00L0 0R0 R Rx00x0  0 Sx0S!1 9)Gr0!9D00D02R  RPP|00|0 p x00S! \*0Grx:!\H00H0Z1 :*Gr0!:JD00D00 S! *0Gr:!8H00H0sS RP 1 P;Gr `00`0\V1 PS  XKOt+;Q0  0 00t00t0>1p 0 1R0 `7 1 , XKO$  0 Q5/ 000 l h )&Kp  0Rp  !l 00Sm Q5/ 0000<, Z1,< p0p 0Y 1- = p0kKl0[P !P =-p p0 p 0 t Jx Gx(0Q'1 =hK0 0 00 0 0CS0 sgj0[Jqp 1D.p> 0x>  00 i0K0!pp$(B(8#8W'!k 0p>     Q Q0CS#bqg [p1D/I d?p!t= 0?L Z1/?2 /Cp0p 0Y 1/?# p0kK,l0[P !@ 4;4+Op p0p 0 t Jx Gx(0Q'1 :hK0 0 00 0 0CS0 sgj0[ Jqp 1X*`: 0X:  00 i0K0!pp$(B(8#8W'! 0p9   ĩ Q Q0CS#bqg [p 1X) l9`  Wf Kх!Ї$&K10) XK6Np0)6[0Q0f0[0h0[ 0i0[0k0[0l0[080  ,P }@0,001S XKNt0(Q0xx80  0 Q5/x00x0Q0 x{0/S00`'2 1S XKMt'7Q0 0 Q5/|00|0&00000?0?h80101h8M? M? h86161p0S l0p00h006[9}|0S 4w202 G 0P ?p0004P ?|040200LS1 |6|&Gr0!86L00L0꺁hhX 1 XKqM$&0W 60 Qh8V<10<1h00h0  0\Q:1 5%Gr0!\5cD00D0LP*1 L5L%Gr0!5NL00L02P  P P0Z   P0S! $0Gr4!&H00H0a0ḡἑ 1 XKLH$0WD4T0 h8 V<10<1|00|013/=X㺯ᴒN  UPH20250v`7Q / ? 67Q`7 !:/0S`77!66`71 XKL`@#@ß   3 ß "0W0 1 3/20276`70q00101 LP400401 XKrL0 PVt7S S 40040 1 3/h8V nx70CS4004000CS 1 x1x!0( 41[L00L00q00101 P400401 XK&L0 $ t7S S 40040q 1 3/jh8Vg "c0GS|t7S[&&&&&&&&&AAAIAJ}A`AAAAAAAAALboAOJABAṔAՁAcAceAAAAAAA -0-P@ LM0 K0  K@K0K K0$A0000S0004 R0 000u/ -L M0@t7S2S K0K -L M`t7PS2Sg 0!1Rc (K0pS\:@(020100010020 0083/ ? 071 01GS00 ۻD1"022222220 " 8,̻" ZNȻ282S887-7 0C2c70r0Q   ⱻ0   04Q   ⦻0@@pCp K3254? -P LL0R`@8pL +t'R#℻80(R#0 83/?G/@0? @D00Q0000L00 _00 R  W001H0 -LM`qF帡_KT; 0 Yf 0( x2 ۺ0 4RSK +x2 P8  R #R"K   3/?mK l2K? k2K71j2K1GS0c2Kc"[ 0S/S1pCq(K K0/K0R"[R 0Q   0   0R"[R 4Q    *aP0pG@? p-LCM1`S@PKp IK_PP IK`P I?K0,X0Q  R ,!0IKR1ā!`P -2LPS@ 0aS 0 6/Kh& 0-0L@3A0ASe ›x00 -LLMh8P @BRV''''''''' ''$''''|'''0'''T'`'l'$','4'''<'''''' 'P'X''@'@'@'@'@'@'''''''''''''''''''''''`GE0 0; 1@(Kn0|7h7 n0@00 ! @   AR! !@T0009`75S S@ SA0100!e R #*`@7`7#20`7<`7#=h7#81h71`76`7=`7#>0#8S >!0R1!!@RlK^@P[d4Q= fK@Pp 8. 0l0K0h0K00g0KQ<<g0K4 0+ P%"%K#%KLK ~0SL0K uh0[0h0KT @ lKQO~h fKa 0 %K%KLK  pG;OopB1?0!6&R!  @ T00!01R !~_@; UL I1S  lKT^@P lKP`P 1S01Ł! B[_@=2qW lK5^@P lK1`P 2 f0KlK1 S@0m`l Kpd0 G1d Rd0 d@TA :pP @ l K(hp 4d @D("(!h7 8.8S0# B)  /@Q'''''0000 㒣&>9 㒣&*9?o2|F8z?x`72x8sn0p:S| (0 3/ @ b'$' -LMP<pE:0%@]`P 5`R H@0CR 0CR  R ? Rt79  R0$00^`?: K4R :0R `t4R^ 0CR 0R 0CR^084R^ 0CR`7#204R 0R70;3Rq 0CR 0CR 0CR`78 3R +0CR3C4 3RY0 ^0p3Rl 0CR =!0CRH3R w: 0R r0Rp!0 # =庳巳zx7S `h800h Էh80000g80(Ƿ80?x7Sh ,  Z0+Spo V0BP C200  R4l`8h3/` ⎷t(r v>0RP100Sh8D!01^0K`75?^0Eh8?B001 ``0P D n^0`P V C VS@`U0"0|`7=$`00 0,0 i;00 Kh(0  0K:L 0000cF%*CEmd b' -L$M@ `8(PI\pP`0'V`F``Sx ^' BS{ +? S  S  S 8p'S  S  BS0V SQp>0 ᅶ  (߶03A0AS2'S  BSL  S\  BSV W?B0CS> &S&  SQ BSV0SQ h7 `70`7X&SJ ;. BS  BS  SV >  &Sk :+ SDV @0SC00P0S Q>⩎0`ⲐVC嶠C  p@0X``%S BS*7 BS  S  / BS\t7S9 cP&1 3/ $S r SGp%VC0S@!V&R!: 1?0l8t7SS3A0AS13/4PpI V&3   R< 8(KR <35V0S\''h''#'|''#'#'''h'  t'St7p'Rh' h' VQ0t8 v΄0S `V2Ɓ0  RQ 0X""0\Q 0V >  V0S h7  `78`7t7Sx7S03A0AS7S7S4p`7  8`7{ <`7V0Ss V0S7lV0SV0S h7 ~ `7 ;Z`7D`7 U ;Vq > `7 K 6Vh0Sh( 0•b`7? 0V[0S.0‘"Ut7S2 `F LKpo B1S00S00 VYY6Y ,0K0 S C  RLK H0R@ Pp t8-%EO -L|M?@QpP ?Q l?Qv 7C0CQ  4Ft?QU 7 0Q? 000`Pqh0GFS/'`0'`0'`0'D0'`0'`0'`0'`0'0',1'P1'`0'x1'1'1'1'T3' 4'5'l9'`0'5' 6'8'X6'6'6'6'7'$7'7'7'7'7'8'`0'`0' :'`0'`0':'`0';';';';';';'8='h='9'9'='`0'`0'`0'`0'`0'`0'`0'`0'`0'`0'`0'`0'`0'`0'`0'='='=QW =Q_ F0Q0 0CS74P`#=Q =Q`7N50000=Q 37Q0  6C0CQi!-0 GL`(K$=Q 0QY=Q0CQ.* 0CQN! lKx7kKSh( хl K l K4! lK|Z<0S4<倌倬`0 x<Yʀ ! `, ! @aRa/#0 UZ,`PW0a/ᠳ0 ! 10`00  !n1S S S`740 03A0AS7S4`|`740`7`740@S"P`k10CS 0'0'0'0'0'`70`701!h8 `750`7`750`75!x0B8#8S> Ñ3A0AS=13/1S|7v>0S2h7  1 CbR.0‘!8#8S'!!`7R00`7!`7R44!@RlKXpPIh0[ S`[9YLg0[St7S>hX fK⠹PZ:3/0g [l[Pp h0[S000ȅ%K" 0#0 Ӳh [LK/U f KPp 6[S>ñ:3/U L4W9 9 fKI PP`YF P!R?lK7XpPl[Qt7S hH⌬ kKEP "1` kK @P MQq`!*RlK XpPl0[0CST4'4'4'@5'@5't7Sk [iR b0KhKPP FP hK t'R R0hKM4`P@ hK @P lK1&[3/`:l K85t7S hK @P l0[S t7S P:4P ` !WpP N4䈄!> J!`7R 331S`75`7!R R R5ny4w5u1S h7`7:mx`7:i!`7R33c!`7R22h'P0402ӑ 10`7CPV!0B8#8S ȕNp@$1S7 W0h0 p WY㎐8 P 1S # "ґ0&!0B8#8S ȕ!18h71019괁 X KWpP lKop'/o"0C,K`PP 6P\Š,K@Q@A0 SlQ 0, K!@ RR! 1?0l8 ,0K@PPlUP e lK⒱03A0AS7S0 Spt7S' cpP_1 3/pX!RlK尊VpPOX  P 03/P 1lK6S003/1zS#H:'H:'H:':':'W $} pP 03/Pz z03/W 03/W 0:03/Wd $03/!R\lKTVpP lKP 0PQ f ["G 6ii8iii9iiii7ii o?DcHc$ci) ' @ @ @A* * @? b-AFch7, ㎈ᨈX#N.^ 1/pG tB W<'<'<' ='$='[) W<'<'<' ='$=' H @981r9#i H 0Y9'90^00¥08100^00¥08100^00¥08100810?o200t7SS!0B8#8SF(ĕt7SS1 C=R.201:!`7R 0 0`7v>0S10x8h'1h"S8t#8,C("(R.0! lKU`PlP[ U>0 X kKF4` 0BSx !R r39S0Sk0 p WGppQpW_0R@ lK0 RTp Wp`:3/>0 00 0Sڐ0 00 >p 0P 0 9l0K0 - P`pW:3/Vpᙎ00Sʇpp W0.0CQ0 `74`R$$  `'`'Rn lKT`P f`700~00 N00@0S@@WP00 0F`PG0T0 TU`P > > 0S h7  `7 ;`7B`7 ; > 0 ~ ˵`7P::x7S t'R `7    ha1|&S68 S!V&R! 1?08l8x7St'R8&S h(0!Sl8Rp8 h(0!Rx7Spt7Sl\H7 000`P `8g X  X $0 3/'`|{ 0-L@M,00 `pPL(00 000$ 0 a P@(0K΍P0(0`0$  0T0,0(0Ka0 ἍP(   $K7AABZAAA @ -L8MP / !0 !p `  @ P,$0 0 ,p(`A K勍0P! $00 0   '.,p (`A K`w0P P"`0`@`P R T:K 8803/Ԗc@G'AA$b"Ad4]BD]B @gA -pLMP`K` @V00 ,0K"bd #\0 0@` 0 0 000 0?oP2@@Tk0P(K -`pLM@K` 'T0PK s~0@ 0 00000TP 0 0ᯅ$K -QLM0 |F a(KQ7R0 p 00 (P00 ,PU0?S%$`1S0 ʀ0 !`x$0p$h$  , ! H4 0! K0 S pR0  0!#0`###  , !Y0Qs#p0pQ P$P R-0  R0h8plU 1l #0 0@弐 TP Ri.0  hP1 ` "R  0X00 qXo Zh8 Tj h8i.T 0 0Q0 - Q0 UUX K0 0/9K0(KK 0 7 K301!S o`(K `CFa(KhK0 ~0K0|K}0K71G [0K2PK5K=02cX0 0T0 D1 4K?<K3K3 3K5K3KM?03K61.0K<1-0KDSP=000 00C0 xpH i[R0 00 @0T iRF RhH V \ @ P0L1S0\ @ 0 G R0 ) b$cDcHcb?0S/0$bD' -L\M@PD @K1# 0!0p`0c_D0K$  ,p(` qP0 $00!2 ,p02(` @000D KH0K[P'> 0H2$,p(` ?!,2 0H0KD KDPw>0 0 0!1$ 0,p(`H0KD K/Pb>0 0 0!1$ 0,p(`H0KD KPN> 0 0!X1$ 0,p(`H0KD KP;> 0 0 0! 1$ 0,p(`H0KD KP'v>0 0 0!0$ 0,p(`H0KD KP 0!0"M@$ 0,p(` @H0KD K̊P  <<1(KƇAF'B$b"AE'̇AևAAAAAA @c[ 0-@L^PN00 -P`L@T0S00`00C0  `S --L M00  KA -@ TL`hTOPP P0000 (~ SQPPPA2A -L M1P@` h8 Qpp: 00,0 2Kh8 S,KHXed0, Ki`0 K,K9X0, KlgZ`FAoAKA -LM1@P` h8 Qxpp: 0hh8S 0f 8`z0K $K0$ Kh*`FAoA[A 0-1L@ _0i K0h`lAJ}A -L8M`1P@ z:08`000" 0p;Y  >Kʪ DKƪ80@ j0 80K0bKS070K"#K 0D K_$K~A -LM1@Pp` B:0 ` 0V00  &K◪ ,K⓪0, K 0Kk0pK_K迈A  @A -`pPL0S0 3SH0L RP@\0@@PL0 0@DTT@0 ɨ0p00@FTNP0oT 1 # 尨0 Pp@D(0`F`(`/ -@ptLQQ 0봒^ 9#9(R%fo59@8 #(R P , WB,@   #(#(0000C0`75`7$Kk5!AA p-L M`1@ 9V00  0O"4V2< "! R 0 0 0S  ! 8Kph/.A2 @5A 0-@0L83/0P +4P +K0h+ r+ -L M@E90 2 2"%|000""? d%901 0080-D1 < KhLAdAAA׉AA*A -LMP@g5Pk`1 80 0C00 00S i V1Sp1 80|  0!oP R 0 0 0S  ! 00KKh&G @HAdAA -`pLP4hHP |0 0 S*/Q00@刐T -0S 0C8C8S0 1 80 Vx@400|bXdA -@L`1 0 <pPUKh2S :0S 3/"42< "!DT @A -@L1 0 `!4_40S4$Kk41S 0 P0Sj*00Pps @AA 0-<0PRp(L@0!qG k0? -LP0`VF0T@8 "@S 0!S@t'?R `'@0 S@S(@Rp 0RP @`7    vP @<1S1@@F @=T+-7 l7  ! d07 ! [X ! ?Q?0 ! xD?ppl0 ! :(L0HH1?3A:A@AGAMA$B.A)AUAA\AWzAOAoAKA -0XgnLU@` - XP v6P5v61Pxxtptt1 S2  PUp4$Kkeሧ? @dArAAAakAwA 0-L@Py3PLL}000AT  ⺭P0@ @HA -L MpP1@` 60! 0 H0 `00! 0>020`003/09909*= 20T1200 0 0 0@0 01 `a R @`Pp Ki2 @5A?? ( @0( 8408008,08088> 01/X'hX''V'V'2 028 0/202/ -LMQp8040#Qd78d7 .0 41 ( ( . h  K 10-L@ `70 0 ,00( `7=`7d78d70臋AA6JA @ 0-@PL83/K0hn -LMP@` QVtxw v> G" Q!PG/  R 0r0UKx7SD1@1  PP0< <!G?0 R  ꠋAAA @NjA -@L`8p3/PP\00\0   p-L MP8 `3/@P\00\0. 1 50  h 00h822h80!P0003/0990920T100PKp @A? -PL`8p3/@P\00\0  h8 0 0h822h822hإh80!Uh8 99 -P`@LA1>P}1 0-LP@P hG G⬥1S 3/0 -P@`0L0p0 ⒥ ⎥ ⊥0?0?h80101 M? 061071 N? (Q 4$Q 0 0 t1S$Kk/ -LMP ` p_@P 00 0YK -t7LPSS` `7M@ iN@p00 R0S P@hH⸞0 -L Mt7`SS@ `7]P i^Pp00S TAT10 R0S wP@hH⅞0S i V1S1 40D D0 0EPjA0 Kb @A -@m`LpA0t7S 0 hXLx0U t7SS PP =$P1 ;40 000) @)A -LMP@@@`p0AT ݐ  ΪP01S P1 40, , 0)0$K@? @KA -`LPV  R 0S Rp✪Ppp`/@T0p ∪P 0R01 S  R 0S R tP0 @0WpP -LMPp@`/ ZP@T/$K0S IP∝1 30t t 0T000AT  .P0S %P @` @f @KA -L MP@U+ pB/P  Kiz/0S0S i V1S1 C30D D 0!IP  Ki K @`A 0-@hLP 0h8i 4P ^%048@P0X%0@80 -t7L@SP m`.088$8/hhXP 0 02222000099}0qv>01p8F3t7 S13/A -1L@` !]Pp.t7S118888$8.PPp (  h8 """" 99>0?`7?0?p'RM?6!t7S`7<`7?0?`7 000  ڢ Xphv>!QG Q W$KkL @AeAA p-LM@PhQKp` P ;P 1 <10<1) P 1 )2`'`0` 0LH  0 0 0`7<`7 @AAceAoAAČA -@LAMet7S<IKin  `-VU .1V6 S2 0S! q $ K !RRPq  Ki83/0]$0K1PPS@57S &1R6'S "t7S`7 8Sli^ P-6S -;`70`7 Kij0SU? #~Q A1 .0 h0Sh7  t7S 1 0!0s2+~Q A1 .0 \0S1 R`76`7h7  1 x E`767`7(V @M*[Kh*Kh@DAeAAA @ՎAAAEAdA -LMPpt7 C/oS" 4 '*```d*1 `0"*0V  (KoN*K* *@T D*00(K0V `t7S2  P D"|0 08" S*F00h8S =00 0-0C024 S RT P1S: 080 ! 8<0 -<0 00HP 0SH1L100P10CP1aFH1S 0 R B0 Y 1 - 0 1P Qܑ13/000S(Sʐ1  0 ⛗ )h000Sʐ1  0  )2S 0 9/000I@Z6 @A/A|bXdAA؏AJ}AA -LM2@SP` p8#8^ q0 7/ KiS4    924Ȕ2<!000v>0SC p!,20S 7-`ǔ"  2 !W0 1S 3/8-8C800ᬁ0 8/: 0S 3/  Ki? ~0001 ,0 CGmP202~0001 ,0 |7S 1 `76`7? 1 ,T `776`7rpq@AceAoAAAOJAːA(AUAQ @AA -tGLpT T) TgP hP 83/@P ? 83/P@`VUPឤ@PgV 83/P@`@PgV 29S 83/P@` 0-@L1 00 0"P3(00K0hm(i @A -`iN@L M@PdhX(UhH 0n 022220000990?KhA p-L M^<2 @R0Ł1P`4`!="P@>`1 0!01] G' '07t1 PV8080$8X1W,h08(h P( (1 0 01in F ' ' 0(' 0' 8' j^6D'@7<7VZh8 h  h'     T (  h8 Kp @/ANA @mAeA'AA[' -L`pjp@o{PQ D0QA T T T T ,TH$H@V`h@&h` 0-P@L 㞛s000 0u t      @v w 0  " @x 0S @@0 @0/ 0-0 0SLP@0. Rp'''p'''<'0 0 a  ] Y0002100000 0J  F 0 >  :  -LM@P?`P000ԁ $Kp0 Pݐ0w=0H0 82 t7S0000(001011 *pP.0X XT00 00^00L7S`P7HgLg0P7hWAAA@-206 2S 101, ʠ,ʠ\1 016300000 @Č\ 0R  R (R R S0t'Rt@ 60R R R R 01 0S ">)R @ -LLM0P S@pL^ <Ky`7 t7S <0["0(Sᘀ*.Ⰰ'X )#[7R 1 <K)>0 07000>Ⰰ7X 0)h7R X ` #[@7R```7 @@ ``X80  #RH L0S0P 00H  0C IRtm>@P0@002B(KY p @?0X 00@0  B    0@@  0-R,@@T >U 0      #[ "$  (0l0  #RH L0S0P  A@P000  0@KAP@ A@0H  0CV00C00000(00(00000t'RH'H''H'''|''̝'0 0⇙ 6K ⃙ <K0 0 00ZD 06\  \  \#*9S00w0 00#"!# #ᇮ0( R00 X00 <KH 6K Dh 0 0<K:  6 6K321303St 800L0 0H0 L00d0 0S &(H0S !%*0h@ T0 0T 00L H00CX0 X (0` 0C\0 0P0 d0\ H0 S1p2Y dYK >PH L0I > T P0` 101P00P0 d0I0 0k=00(0080h0h `0 0`0 \0 0S\0 000(X0C=0P 8000000C001l~00 GG=P6 P@X XL o 0[ Q `'b t'R8 Q[  @  8 QT ( H0 9/PH0K1 <K(H 81081A?yA @AIA_ApA'A -LDM0 08 < 4 @ \P P`  ` \``P` PPPRZ\\9PBQ8@@ H D0 @PE@wpPD0H 4PP 4QpP 4pWP@P 0 0 @0 W0@@ @@T@80 000p W 8<(K <0000(Ko @AA 0 0- @LT@@ ʗ0 0-@LT002 @D @ ṗ0 00-L @᭗0 -`7L`pPT 00h 00 000S R  00 00 P 0 0`|P0 000 8qP0000@ @0 0b0 000 X@9D09P#40dQd ä^`7@[ "0@hx 0@x<0@00S R H @,0 0 00` 0 0 `0 00 0 `0000@ @0 00 000 @9S0ą9ׁ#40ą@DAdQd DA @@@@@@A#@'@+@7@/@#@C@ A - Lі G@ -L$M@1` p \&0 "`0 2!GW0550KPP000 n0p0 Ƹq?0080 800 W0   ፖ00 000 0 0 B (  3SH0LPP0  >PP H0 00AS00S A  0pw(0 ` 0(08@01011011 %p`x 0L00L7SPP7HW0LWP7(KP@9ABfA -L,M`Q@p .1 %0)`0 9⨏0W _W W W^80KS>HHrPP t7`'S000 p(  0/  h' ;0  W000 0 . 00 h ޕ00000 0G0 0 `70   40S  0 Q 0录00 000  000C0(09W PW0 1S E%0 000@W W1 0%0 0KPP 00ᰀ00(0101`d0KkPP000 @ 0 h80?0 000 t7`'S000 p 0 ;0h 0 G0 rp7S000 j0000儦 0  0 M?0 0 0#40 0p^0000 *#300pT0000 *P #à @00 0 6! t7S0 0 0 0 0 0 00 0 0Y 0P0 v>0S*00 000>0` 00000B0 0`70    50 0000 0  p00 0 8H#8 CR,S  R Sh(  B/o"YQ8 0K @0 < PP< @00 0 0 岀8 0R㴐 #80 @, 㕔80S 1 *$3 0:0Y(110011t7S d #RH L0S0P _ <PPe30KPP `'00 p 0 0 ;X000 0 岀00G 0 " 1 1000110 `0 l`70   40SN00 0C0(01 #0 0KPP 00尀00(01010H  0CS00S 00C00000 `(0w 0(00000=080o0 /1 PWt'R  z#1Grppq 0 *1 0100L7SPP7HWX0P70LW嬈2>@(K, R :01 L#P0 L0@00iAh@9AAA3AؓALbAA|@%A -`Lp7PP 00(0K0@ 000p–  | -`LP7@P 00(0;0 00`0c -L MG` h!=0- 0  p@ 0KPP 1S 0|#|000(K 0Ӓ00/ t'`0 R    0  + 0 `0    00 0.v00 S 000 0000 0  0%00 0 000t'RV0 000 000 000 !0 `7   *`70 2`7`7 00 0S*00 000>0` 00000B0 0 00@1 0@( 3SH0LQP0 :PP    F  00000 01H0 00BS00S  B 0(0 0(000岐4i  e a붑%@]AzA -@LMf pPt7`'S000 0 0  ;0`7 . 9) R*!  $"$8089R:!  !808x09`7  k`72`7t7S```D >P00 U!=0PPS@(Q PU0C0(SPCUe!0 R ! 40 N 40 Ⱁ P@!Б`75`71 00x 0 .0S00C00S0  R  R00 q(K0@AAAA -LM`T1P!pR@X10X11S .!20 0X11 0 GKh9>0/Q?U0P00L1EUS0 `HaPE0PLaPa`Pa1 ` 00V1Kh/K&ATA0 / -2L@SPa0 6/Kh 0: 08x880 |80|77090t(10101/* * d'(&' 0-:L@0S 3/ ]:S00K0h/ 0-hLP0ST0T    00U 00!@R 01j000bؖc@P0/ؖcP 0!/ؖc 0-@L 40@0耕A0b0 R  '0bA 0-D0LP @R,7@T $P@00b•A Q-@` `PLU tp`PT \Kh0 0C^SP,P$p0EV /ARA˕A A -LM1@pxg 4!1000$xhXY 'ܾ'ؿ'|''`FVо''''t7S S 0 8:0S 3/$Ka0 6/  t7S S a0 6/dV'4'''P't'R/I032+P3Q' `7  %1   mT`7<`7hi,P <10$1v7SV񟗘''''('0a 6/Wa0 W W#7S}a0a 6/0x7rVo'''''1Sg !b0a 7Sa  UV '|''|'t7S 1S 0`!!h740!qX r Y sZt9[9 0W901 !\0ɿt7S!>0S8v>0 01 r9Y9 00 \0ᮿt7So900o9`72`793/1  t78 @S$9o9Kh蔿h82K@0b@ЖAA,A 0-h7L@0f_nK0h -LMh7`j Pp㤁v>@WAN WP W!N|10@t'RL %) &) ') ()0)91  )90!00(9 0'90&90%9011?0>9 ?)@A B  00  1 'pWPh8S  s $Kk0: @X 00: 0%90&90'90(90$K@@@j@SAbA@ -LM`7@!1  tQx7S8(00S8. h (0   K 1(Kh/@AKA -pLMP`K` L0K@K0 0 0` 00000 0\@ c0P?o2^ 0R: 0R : 0R:0(K -pLMP`K` @ 00, K0d0"0\ ` 0 0@ 000 0c?oP20S R0 (K 0-LDM,00 `@P(0|100`$ A 00KpjPJ<1$ 000K ,`(A jP91$ 000K ,`(A jP)0'00开$00 0,`0( A0 KjP0$0t0 0h0,`(00 0A00 KqjP  ,,(KABAEA'"Ab'NAgA@ -LM@0P 0SY` Yt# 00000SW 0P 01P 0jPP 0 `(K@0  @T@AJ0P0^00ఁ0X:0bXA 0-@  0 L !    @P 8˒404PPP,9rjX0耖@B -LM@pĠ`P A< ਒0S D0P @{0@ 0p0/$KbcA -L$MP@0d001pX :RK ,0PE Q1 0C(Ko0S`S`3`#a0 少  A> T0 R" |0P ' 0PQ`p!P 00  j P P00 (KbcAbA -LMP0p00@P0P~ 0S} S} S@0b RL*A001QC0S  1 00 "0P00 ⊠0* 40 0 i400  hu000!A\> ȑ0S- /P 0@@U0S /P @@ D㨠娐 =@1S ʈ6 XP(K@@0a01` 00 hi00 @bcAb A7ANAVA@ 0- @LK0h@ -LM 4,4 8 #8 KoA p-LM@0PS` Kp (K0 0(0KxALP/D@P/00S/H -L M    0 % K9c -LhMp-@PI (1P`0 P0P0(000` 0``` @ <P 000 0C0`0``J 0 0C0000 0X@S2 8K07K0K0@0*s$`pdw$Kd c9c 0-@DMLL 0H1 00 @@|P| 1 0Ppl!0 000,P(p$@ @@ @`g 0!0 0040P,P(p$@ @@ @@g0 400!d080P0X0,P(p00$@0 @ @`0 gA(K@8cA9cAA'y7B -L4Mhw@`P  0 0P4#(X *!@PA00 0S 0S*0`P@ ̾!`paо(K0 H p 0Cp0IP 巾!0@K 0C00 00P 0S S S5坾" 0"ើ3'0 4R8 00好$ 0$ᦽ0S -:S+00(0 0S0剽# 0#ኽ3  04 8 < R $(,S e# 0#f  0S nP `0#$ 0 #(#< 0  048 }@P 007$ 0$8 R02& 9c@8c@9c 0-00L@4S 3P1 R0 0S`A`2͎@a0SLP 000 010S100 @8c@9c  BR/ $R/ #/0 0S/ -L MP@1S `pt 0,K@1h @To  K0S 0CS0@q 0S0 0S,K8 @@8cPd -LI @0@1S KhD R  R 0@8c 0-L@. H0Q  0T S    K0h @8c01,!,"/ b0!,21 ,/ bM!4! #4! B#4!0 PЍ/60S 000!S <S21/ 0-@PL g!>000000 -L@P`LBT D@DT00SH@P/ 00-@LPP }@0 00-L@P o@00 -L0  KhF 0-@PL@T@K0h -QL$Mp@`0 Y@K P Y0(KV` @ @ PU0B00S @T@K  ?00S 000S0L0  P0 DKD0 0\0P@H@ `X 0H0 0 R0 L\0P0 \0P @@K H0 f  @H0 -LM,0P0PM 030```p 1@T @DT 03  D/,00,0P. 030 00V(,0%0K` 03  $/,00,0 03  /PP,00,00KK@c -`0LP@P`p*V 4 0 S H0S 8 R 30 ƊP SH0W 0S 0CLP 0PX@P    " 0PP %0x0l0H0'?azZ㰆 ,19 066 06 ?ꑚAYc' -LMF`@Pp !> (K,0 ,0K $@ @ KA 4 #4 # /l0Sp p l p0 0S  0 00/ -@LPp`1Sl01l dp AL 1` p P 00101S@@_jqc@-@dd$,d,lH,$@l  .  -@plRl2@ML p00@@ #0A100bA >   EF? ܨa> 0P`p!10 00p,P(`$@ @@ @Tb0 000!X10P1 004p,P(`$@ @ @?b 0!10 04p0@,P(`$@ @@ @,b0 400'!0 008p0@,P(`$@@ @Pb0 400!l08p00@,P(`$@ @ @P0 a$KcAA'A~:AbƚA֚A 0-LMP 0@0T@0S 0CS d ` R 0\0X 0S @T @DTK0@bc p-`L MP 0L"@T RD0B@  R\ X R H0S D0CS@00Sd0`0S H R D BRKp@b0SM 0S Ѝ/0 R/C\ 0C00/0 -LNt 0S0C Kha \ ^DpUT 0S 0CSR$!c 0-P @L WK0h c 0-@$PL 8000c 0-@L    K0h ' 0-0@LMsP @% L2S D0C SK0QQ Q hQ R `Q XQH0S D0Cb -LM<0PS 3A0AS `LBTD@Dp7 K00S)8K0 000S  P 0S000060 0003/8KH@T D@DT c p-LM@Pn`LBT D@DTKp00S0Kju0S 3/0000l6I0K`\H@ 0-@Ll1K0hQ Q/k 0-LM@ P <偉801PK00S 0S c -@ L M@ 8<@ @s<K@@ c -pQLM<048 `P 000P<$K @PH  00!>  p0K40 4 K,` (` T P 0<⭽@`#P $<⡽ @`Q 1S0 ` 1@0D A0, (1 0(1;c1i c 0-@LM;PPEUP ;K0"!> K$0 囀$ KP P P 0LtMQpP` ..Q #B%BQY V\ U P.U !BU> R R   pQ  @ TU& =U# 1CU"0 \K&~ lK~\K }~0S LK v~!>8K3K 0`l Kp"00 |0  K1!(00R|0 -LBTD@D|A1p<U Kh1!8|0 0SZ 0 80 S H@T D@DT }0Q 0S0 \K0 } lK~0 \K~3 LK ~LK ~ 0l KYf 0 Y @ lK 6@x{UL )l;U 26UC 2C6CUw UP @,;U 426U 2C6CU ps:U 0UY~ :U0CU6C20C2:T< U( :Uc t26U 2C6CUv pRd:U 0U0ST lKr1ᴡ ą:0AT @DT~9)UU00U0S T\1p@ 0 S0Z0 @U0S00T }0SZ |a}0S 9U0S /p괡18ဠZ(8UU  0 \ T800 8 0P0 0PTp@P 0| 000?893 !>8Y8F000000 NUg -7U 26U 2C6CU7U 0U `|0X` d000 0`  pD7UX 0U ,7Uf| X p"6U< 0UV|K00 |0Kp6  0PP;T) gL6Ul 0UX6U% 6C0CU 60U6U 0U 0CU3H 3@ 34 |K⌠ g|  9pP |0K(TX lKW ,0 |0K0 & &t3 p00 0  )pX \df uE0t01x0@t010S ؀SS `0؀ bKW 0pW p 0{0d030 !0Sp0 0 R00 p pp  X  0 00 0   p3 !0S { 0{3  R    0S{I{00pClKkL2 @0S 0S000`S 0 b`r0S  WZ 1 p 7p p-p4!|0|U= ]{*  V{ @P% R0p10p:(KlK'0U 0U 0U 6C0CU 60U ~h0U 0U~ 0CUuUZ ii iAii@iii A#i%ici@'io b"i!icjc;08 P R/ !  /c !  c5 c'6 c6 c -LM@Pp !`0@0@@P.10S@CZ T#100@ !>8K<0 z@0K <K4@ 0@ !`P H03}H0LBT DDP*@ T 0X 0B?o20S5 0S2 `P @ uT 10@0v,P4 $'4,$8(#8"(000010 -L`P,Y@PE s00008$00(`088,P@K0 ` R 00@&P4"4 8#8 ! R 0 1  &4"4 8#80 A&4"4 8#80 1 0570c -L\M(0@Ბ0SP,`|  RRd0&KP 0  00 "p pP d lK$sP^d0@0d06[0&[4"48#86K60S   &4"4 8#8 ! R 0 1  &4"4 8#80 A&4"4 8#80 1 0#"44P8#8 S0 #0 30 8P|KlK 0|K᜛P (01 0(KH0[  10R<10S  0$P5H0[6 W 100S 0P (0(t R!  x K$0 q0 0 0 $K(0K8K8 -LM0 4 8<< c#,$c4"  #$  #(  #< ʹ K A p-LM@0PS` Kp,K 4"48 #80,0K⪹,AYYpIlQl Q 0S  0CS0#0/Q 0S  0CS0#0/ 0-P@LU *U  R BwP0E0T  -LM40@ R  K 000 K -LM40@ R  K 000 ryK%0 -L M    0bn  K(c -pLM`KP` @q0K\0 0`@0 0 0 0000 0H?oP20S B~Q (K谟b -pLM@K`PW` p0K\0 0P@0 0 0 0000 0aH?oP2PPU@ @T@p@W T@<m(K@T @9cb 0-@Pp`DML!p3$@ @@ @0`0 0,P(pmO 0!(3$0`$@ @@ @0`0 4,P(pXO 0 0 0'!24`0`$@@ @0 08,P(pPAO0 400!|20`$@0p2 @ 008,P(p P*O0 0 0!(20`$@@ @0 084p,P(pPO0 0 0!140`$@@ @0 08,P(pPN0400 0 0!t10`$@0h1 @ 008,P(pPN0 400!$1010`$@0< @ @0 08,P(pN0400 0 0!00``$@@ @0 08,P(pPN 8>{1AP@P5(K臚A  K0 n( TK℀ 倀 hKn0K0 0TKK␀ TKZ (ᰈ  멺 v|401S3 РCZ(帺Z| XpW8 LX- DpHW ( X 0  R R  H0 X V 0  RHhKr| {|KVX U@3`0S ؠCZ'gX%  nn Z  hK T01CY0 `kl `P `PD   Qn 0 1 # 0ShK |'Ru S" pWWQDRRR  R  0 l 0  0CS R0 s 00bRSJ0 $4"4 C8#<40#400 0000 (0 B C0( Bel0p,0,00  PPQ B p04#!AW/0pp0C00 PP06~p 0S   hK hK    bcc c -LM$KRK0 0kT0`( "4`#KQ -LLM!npPh  @ZK(m JKeK#mdK04# )IY ʄV֣"`pbڣ$Y $0S 0 3SH0L0S@P F嶣"`pb庣(KP0 0C0.P U堣"`pb00000C00(She口9  0 卣 0 BRwLK(TL(N(L(L(M(L(L(L(DL(M(L(L(L(N(S1L( L(dL(K(K(K(L( L( L(L( L(L( L( L( L( L( P#Y 00S00 RY% J#r PPP PSP7!;*SPSP P0S@PL   00S ,|1x2120d#0S  3/h O$30S 0  $00# -Yڢ#x20S 0  ̢%00 (2 0S Y 0XK4 8 <0Cs  Kl PQ 4 2b -S_ʈ0S #Y00S!00 RY HK!l0 X0 1\K 21` 2`0K0L0K00`P 0S  yPP  <K-0< K㭴`P mj M\Kl ߷lQ 0000 04 8 < 03   k(cb$c@9c:(AПb -0`L@'1@$Kk((c -LM0 pP(@P 400( K  0 P $K(XP Xk(@1 xMXd'dh&hVp 4"4 8  #8WS  R  1CS0PH0@0!aV:X`؅0 JV:pHWV 0 %T 0@Tl 000WV03S PP垡$墡f003/@Пb9cb\:(@b(ch 0-^ 0SQ !R R:0QS  0C!@ -L 0o谟b0c -LMpQ`P40 P CO  0 P02"0 4`0S XA0B?o20S  0R:!R232 |B&!*(Ko 0 80 P0 $"44"8 #80CS00 RP:P01@ T00 1K00 PTP0 @(@2(X2 厲 PLAڠ  0 ٠0X@400 0 X0 XYZ 8#< 00  0 0000  40#400 088j 4j @P g(cbϛA -xL⹙ PV@X 0@@Th`pTG4rఀ0@0F඀ 0-@LrK0h蒙 -L`P+@g0 P @@S @08@H #8S00(0QAA  P/% -L M    0" K:c -pLM`PK@` i0, Kd0"0@\ 0 0P 000 0%A?oP2@@TPQPP(Kb -@LMPpK` `ci, K0d"\ 0p  0 ` @0P?o20S00 P00(Kb -L,M0p|L P`,0 C呟%`pe啟P(K048 P 0S0 p!>(C 8K<0 i4p 0p h0 H0 <K@0KHPg 0  04$#$0("(DRD =P 80p"0C0H0SP40@M008L 0LS0 0SD LPA 0 4 8 -L M,0 0tP8 ( p$0 0 啞`00K ,K@@P啞KL 办L:c -LM$>$n> LP>(Kl TKm0Pp0 D =0S S M[ _l0 =   Pl F!JpTKlP0S'Pl M l@P0@S (+@PKPQU"@PB0UPl @ 04 8 < R.@PN $(,(b" b$ ",R c(#"c4!#<Sp03 p0l`1, @000@S S؝ @P@p03 ;0S (P04!48#8U弝"@PBl(S屝!@PA Q0(0 C ,K@ 10;0 04 8 <0 p 0^0P0 lP 0l0 剝 @P@^0S qPl y!@PAOl001S|0 M0| RYPl C  04 8 <0 |0S l0p0  0P4 8 <0 0010C0 0@0 0 0 x0 0STh D90S@a 0@K8PP[  @K0l0 Y YJ 0S@/0t0 t 0SRQDY Y 0t 0C0 PY Y bK=f!>6KH80Sz 0S @Et0SZ@@D  `KfX dK;0Px0 0lY3@0 G0pϜ*ӜXt 0J R*+Z 0  040 0P 0 Kf0J*  00 @ `K;fY@KdKP x `P  `K*f &f@K 000@@@T@ @ bKe!>6K0S|t0SP0S~t C0R: `Kf@KdK0Px0 x@K`P@}   e@K 00000 ;0SOt00C $R! ROR0 #"  02R0D 00 " B0 S  !:S6 @E@7 >K^e!>4K0 0S*0<0 剱ᇱ0$P ᜱx0S  ᗱ,K<! @ d000x0 e ᄱ000 >K*e!>4K0 0S <K~eS@K60Px0 ht E3pPU 30SPp0SQP%P0@`D0H0LmD301S 0CS!p0# p0L2SD0C O6000 0SF pP{唛%@PEj T U  pP     ^ p #Z0Q  R TJ hTG `TD XTA Q> H0S D0CS@p610S TKp%H%@PELl 0S TKp0 0l1%@PE50lp STKp0p0 ᫰TKp0 40S lKLPl0S 001|0 '@PG, P0P#| 0l3/|@K~x Pd:ccd bbc$c@ -LLM89@P`p000`,P(p00 $@ @@ @RC84`,P(p00 0@$@ @@ @?C4匘 0 00'!t88`,P(p0P0 0@$@@ @'C 0 0 0!$88`4P,P(p0P0 0@$@@ @C0 0 0!78`4,P(p0P0 0@$@@ @B0 0 0!t78`40h7,P(p0P0 0@$@ @B0400 0 0!78`,P(p0P0 0@$@@ @B0400 0 0!68`,P(p0P0 0@$@@ @B 040 0 0 0!h68`,P(p0P0 0@$@@ @B 040$6 00!68`,P(p0P0 0@$@ @B 0405 00!58`,P(p0P0 0@$@ @nB 0 400!p58`,P0d5(pP0 00@$@ @WB05 00!548`,P(p0P0 0@$@ @@B0404 00!48`,P(p0P0 0@$@ @)B040 0 00!l48`,P(p0P0 0@$@@ @B040$0 0 0!48`,P(p0P0 0@$@@ @A0403 00!38`,P(p0P0 0@$@@ @A0 400!h38`,P0\3(p00 0@$@ @ @A040 3 00!38`,P(p0P0 0@$@@ @A 0!2(p0|08`,P0p00K 40@$@ @@ @A 0!d2p0pK0X2,`$00 ( @ @A 0!20K02$ ,`00( @ @oA 0!1,`010 K0(0$@ @ @[A P  ,l hPEE1\1`PP@ T@!0@Tq +(1 1˘z 0-(K R\\ CBQ ,0ꇚA~:AbڛAAAY(AAAAb)"Ab.AX(:AbIAbTA:c_AnA bxAX(y7B cAAD)A)A)A_(@.$c bYc@c:c 0-@LwY K0hPdD -LE @PP0S  PP `0 010qa00  :``p` W*  aR pG`Fa 0-@L0S0 000@c 0 /@c -L8M`(0dP@p  '@ 0 J,P@  0 @,P@DK`P$    0Kva2 ,0 00K+,P@ P"0 PPPP0K0 0[0K,DKK -0`L@尗1@$Kk豗:c01,!,"/ b0!,21 ,/ bLP/D@P/00S/H -L@`P@P  P/ 0-0PLM@P R RK$K$0[0 P0S0ĕK0 -` LPR@  RP PRpTP̬1P 00ì0\ Q `0 0!0;0`` 0!l00S `0P0H0! ("(P Á " /b:c@c !>0- PL@0P` K0h*` -pQ00`@Lf8&#DfD$$<PP W@dh\001S 0CS V  P#RP P0c -LDMPpdK `#@P"d0 R@0`0S'X@ ( LK_\K\KLK@P LK`P 00LKLK KHP P``KXP1@P P00 -`SL@P = pP0 $Kk/|P/ -`0PLpPQPEU `f @ T T@0 @U@  _0PEp -L,M,0@PD0 0QD01<0 04 48#8 :T0 \1 P 0D0 <0 B0S00 (@(K0L0 0 <00@0 40 0H0 080 04#40!SE@0CM@0@ (08#<4 0#400 4 00#40D0@ <   ,0@0,0X@  00CH S  T R B姕(`ph7@㪕000T@pP dB叕(`ph哕X7@`L0 p0L0 2 ``_0! 000<0S (080 8  0-0"> 080< 40400CP 1T 08#(#< 004!408#8Q :0C0Ƶ#400 0Ƶ 04$4"40#48 000 80 #< 40#400  P D0( @  8=   匐)`p 0)H00 0H0 40040 !,0@ ,00,08 00800p`PU:cdv -QLM0 0@ 0  0 `H$4"48#80S`:0P0 P 000000xNC10@00Ȕ'`pg̔0S( TK]T0K0 K0Z 0S 0 (048<R  @P @PKPP0K0P |K pPm\]`儔+刔3PBp 04 8 <   ^ 7 #RH L0S0P 2YPP 0 0C00 0000<@0](0@ 0(0]00 0 $4"40h&ld`&d`Y0H  0CV0h 0 000\P10 W `@00 000PT@  ` 04 8 < sRSs<< 000S00X0Z+! 04 8 < sR 0 \ 0SY PV K`P tZpʓ+Γ3PD|K@4pP9  04 8 < sRy 0PPr3o0jPhT@P H0S Y唓+嘓AP$400PW%00 `qT@P Yr+`pkvpAP`LTP H^+`pkpaAP`@|KLd`04PS0 @00 $0 W0P&0  #R>  39 04 8 <hKPP 80S hK80K3/PP hK \hK0 48 [P3 0S 0S- PP( 00SPP ,0   ,0 0,00 0 00  0  K0S 3] P|KC T0KR)V K(K 04 8 <80S |K"80K3/pP |K  .\ 00S lU剒(卒1PU 3 0  04#$S R0%<#*(P0<00 0(DQ  ,   404#0 @0Ac+ W |K0 0"5 0 4@00#400 KPP R s& @@)p\ 0  00 0K| KKpP03 `30S ,0@0,00 $,P4"4 8#8S : \1P0 0 0,0 "@ 0   ,0@0,0 3  20S 20S  ,00,00 㰠K 0  PfU 3  20S 10S ,00,004 0Q0  *嗑! lPP Q U8|) 0)~0U0  300 0  K 0Pp P PO RL F R  hKx0x x141x00h0K⎣4;( 0(<X1P:cd:c bhbb c b @A -LM`@p  ((tTK0S  SP S0#03R0S0S 0 00000 000B00SQ QR $KZ0 $KP R 0 0$0 * -L,M@pTP \㥉@P7P4 0@#00 @0 0CS8( ($(0(D( <KPP<0SP 8K`<KP 3S.1P0S  2R`V\ᨉ` K2080S3[PP03[0 P 0@0 0S08 K0@K<0KPP+@Q' 3S$`< 0V V;P08 K0@K<0Kx ^ R `<KaP 0007P1P@8K90P`$K@` `!0S`@0K8 KhPP`<0@ V1P 1 0 `aR0C08K<08 K0@0K-S S Q ` -PS p-L M0@ SP+ S. S- T 0S   KuY KDKp 0"K1K>`P -P0 0  @ KZYKP00P0 K0a c -LM080 0P`Sd@ H&S<6P*(KP Pk00CS~8(̠((((((̠(\(\(\(\(\(̠(̠(̠(̠((t((̠(̠(((((|P 0|00SC  @0 ?pP@07`  @0 X@0`S)Z S `VS`ZZ0VD0 0 @0 X `F` ,RD0 X@0`0|pd@(V X8KwP~00CS(((L(`(t(l(l(l(l(l(l(l(l(l(l(l(l((l(l((4(l(ĝ(80i080p080 CR0ŕ80S@@80S@@80S@@80S@@80SKK8K0P80SJJ 4KP,00S3[83[8 1`0PG1P 8888<P~ 8KP80S3SS @p - @m8KP8W0 CRwT(̠((((((T((((((̠(̠(̠(̠(Ġ((((̠(((X((|PB 0 WP 0CS( ($(8(@(((((((((((((H(((P(((,(i080 8p0000D600D135 R R D8 000 84K3K83Kp&l  0$*s  -@PL `P0S\KhP -0@S L  l0`  B   B PUKh^ R0 0  sHc -LPWp̀0`ATp@W< 00C@S𫝘@p0S00C0S0奍$ 0$ᦍ @1!  TcHcHc:c $1- l0@PpDML!0 000,P(p$@ @@ @5 0!0 0040@,P(p$@ @@ @50400 0 0!P080@0'>,P0(p$@@ @P0 5(KHcA~:AA p-@`ML0P0@@ @0 JhP ;0,@@T "0 Q  B! "KphATbHcPb ,-LP54 Kh_Pc -@L'0"0R S  B! "2 2R2S0t`P"0#Q00S qPP@UP#00C?o2PKh%HcPbbPc -LM0 p 04$#4 8$#8 Ƞ $ ,("(!8 8' C^ࠃࠓ^ G噌,`pl CSP |G匌-`pm同(K0C40 0@0  40S (P 04 8 < #"   "? < !AT#]# 0#^6 D0 D0`PP#00 GM 0-K00 !R S  $(,R  P: @@0 p00080T14010 01   0B0000_2S S?$e@P: 0 000 001<00 00 0 0410 0 U U<0!0Q1@0A40000S0 ``0`0 `Vn   Rk  !Ro8T廋-忋00`'1p01W 0 !1Rp   !* !! Bഡ R*!AQ ڴ! Q Ƞ,Ƞ B! R@ Q   p ! B!  B WY R ` ``! R 00!` R  B   B  `  p֗W2 p !p8 #<40#40 T T@0 0100 01C0T00V(p,@`Z hQ(`ph y0  40 嚗 D 4p0@p 0`0PS 0R ,@PL9R00Yl !Ს!JZ7ڴ!Z)10C10X@0C0#0 #Š, TwX:cHcHcPc-//-/-/ 0-@Lca-0 p-L MP d @ ` d0 (01  0 Kv( 0 P(7 P 3Kp1M  r 0-@LP0S 0S 4P00qP0*P 0\c -L A -LߛA -LM!>P@  0K40 S,P (P 0 p$p4"4q0C0#40 0$4"40#40t1`V U7 04 Kn$K0S*q0S S%t R 048<Rx R  048<R U P 04 K?P`, 0x t # l0Rd@0 Pc‰&`pf'`Rpg‰|\c$c@((:c\ `P/0 !`8 0 0 (  , !/ b$cDcHc-/ 0!< 0`4 0 (   !/ b$cDcHc -L@p@P@`FPd\c -LP`@| -LP`@ 0-LP@0 -L@`P xR c 0-S@L@%`i0p0S S 0S/@PdP0 8 1@0ꍞ070@7dd -LP@`;h0p0S S 0S/@ 0S@070@7&B1@d 0-@PplDML!1(p 000,$@ @@ @P`>1 0!0(p 0040,$@ @@ @P`)10 400!h0(pdp0`0 00080,$@ p @`01 (KoZꇚA4(Blm)\c A -LM`@  $ pP 0PSq R R x 0Rt $0R7/@K -LM0S0SP0!0@PSR \ d 0  $( ,0 K0 @%(\c -LMS`pP( b!@ $ Kp KQ`0 KKW` Vd (0"O0S  #RH L0S0P  @0H  0CS00S 00C0000T7`$ 0`K(0 0(00000q0 0( )040#40 ZQx VQ00|0P8 00`$KSESI 0 #RH L R !   @P ` 0 ($ Q*$ , "$  $!$ "$  04(0DSʘ000 0T`00 j,n(`T $`d:c -PL@p`U1! #00S) S' 0S&0S%07070 U@  hxP 9@8@X W 1@/@@d c p-L Ma0SP@ 0RPd0C50/ P0  K U0P Rd  ++d KpS 8P P0S K80P d Q  0Sd00K0! 90  0`( "4`#/<08 SD @R C0BP// -0L48 40 8 00 4 8 4 0 8 00 $ 4"40#4 00$4"40#40 -LM KP Kh - RL \`"0 @ 000S  , T0,  B DF 00C0ĠccP 0!P R    F@|bp( 0-@LP 0;@0:FP0K0hF -@`LDMpVX(KP0U U X PXU0CS((t(((h(h(,(U  0 ;S0^0K0]0K%[4"40H`U 0 ;S0@000Sk10 0#2S S . (\K .\Kk!\0K k .\K} U0 0LO EO 0 ;S0<00l1d00p1U 0 ;S800S0 <00 (A2Acb -X`P𝤀0 !`!800 (  , ! b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc 0-LM 00 00  Y K_Ac 0-LPɉ@0萜c 0-LP@yK0hꐜc -LpP~PPRAᓚ/`po`1, 0 00S S S,|R00!@` ` $8 (#<4 ̂ 8 #8  ,(!( 0`#8Sʬ S 3 00S 0 PY Y`1, 0 00S S 0@ (00S 0 o긠cb 0-L@ $00CS R  edd  B BL00C00@0CTiA -LaL@Pe#iT!R@ 11c R T!X!S0cB1C0S0X100S 00S 0 T1R0`2S *05Pb0T!L1;X1PYO1 C10UP1SP50S00002T11X1긠cbbbb|b 0-@ML 0X00P0@@ %8040Q K0C 0@0{AcԢbȠc -LMlR@0Sllm0S SX 0 (68!#'( "`01`qU\`e  4  0̑\E布̀L 0L幃 ; v00;W10S1  0A0 0v"̀000@0@00000匃 @@P@@參4(Ko$(68!#t  " "1\:< 00 80 j  0 m 80<R@ ~! R00R !\  0 ꈜcԢbĠc̢bcТb -LP`ATAKhp@ -L M0pS`P S1 0<0 @H1!@$080#0 00 Tภ 00 PU `00 S lRP RP (K0@4 H1!$00#0#100 PꈜcԢbĠc -LM`p@x( KP`Pq$K 04 8 < 0CS0@N彂 @@긠c -LM@p`K( KPs@PD$K048 0S; +R0;4`冂 剂I긠c -LMm0PS S /TfP 5<@0 ` R_p0Z !7=(p 0p`0@00K  K0 06@0#4080#40v 40 8 0k 4 0 8 00 0X Y040#4000;#40;000S K; 0    ;0 00 H00 01 0(( 0 040+00"2- 404 14!0CS& 0#@0 04 Ӂ%΀L 04 LӁm04 S000 SM 4 彁&΀L 04 L彁m0SM Sg m00@pS S ``0 0t;K 7K006(@p*0#4+08(0#4)0N0S00 00`2 h0@d u Hx048<:#0##<000 H8 #<4 0#40 0H  3 (41 (0000 H8 #<4 p#400p00   0H k 0p0`00000y 00S;W   %(KzPPH|p0W  0 0 Ɲ0 40 0 5Jm0S SL  啒dcd@AcbbA -@\aLpA;8Q Ԁ# @`p 0 @Հ@(#; S# p0p0p100P!W* ᯀ" 岀*;0;S,Ko ᛀ @`p 0 @圀P 0Pdcc|b(b -LX0$S0!0 CR01 1x0~ `p`~@}g00 04 8 < 00~ p000 04 8 < 00fbc|bbbDbbHbPd -LMP0p0H2 @L T 3K 0S00x1 0;0000 0fP(KxA 0S# -K@`P' `Cm~!΀ L 0 Ln~Z P 븠0d0 PS~+`pk)`piS~P @P2TZ  sG= lG GkḠ 04 8 <00S[ Sc 00; 'm1L" RX X0100Ch00d0x1= S;0;x1`0`S00 0[201 0 SQ=x1  X10S;0; 0 810S;0;H20XPP(}+`pk)`pi}H?0 `j0 `00 00H`VnC}! `p`Lꐢbccccbb -LIMh_H0[0 H0K}.`pn} KF0 *0p0S@%0%*0K  nP 0 Q@%*@T [} `p`^}(K`0#2S SD 00S X 04 8  P0 $"44 8#8C0$1 00 01  pP `0` @ 0#21Z0 00 R0SA } `p`} 04 8 < 04 8 < 04 8 < 04 8 < 0S (0 C048  0$1 00 (0` 1 ` RJJ 00 R@0 0K  P^ 0  QS@@TT 00C1 01 1 S  0S';P  0P00  Q 0 P 00 y0P1 =P P0S S pp (1 1 l0K 00 $400 48 < _0P0 Hp[p H0[pb p꜊U|΀ L 0 LV|0 4$ 8P  0SWH0[z3|΀  0 4|91S" 00SVpKU  K 04 p$#4$!$8(8"( #8 KSQ9 P 00 K fKfl0K p00$K400K#opPH0[{΀ L 0 L{ 0$@Kop @ 0K0 00 0$00 l0K0000400npP00 PH[5 H0[{ `p0 {`71S 00S0`KS .s .Ks 04 `$#4$!$8(#8"(  Kh j{΀ L 0 Lj{ 0$xopP  0SV  0R:0P(UF ;S  04   ! h!2W0  h 60S P 00 0  100 1  K]D KYD0S S 00S 001   KK)0S . 4. $KxWP(H0[P  0@` P4 8 <`FVP 0#0##<00 `F4SP0C0ą#40ą"PœpĕpĕZ0RPSTPz @`p 0 @ ` 0 z `p 0J4 8 < 0#0##<004V`C`ĵ&d`ĵ Pţ ĥ ĥZ; z @`p 0 @z` 00 04 8 `<0S  04 8 <@ Srhz΀ L 0 L  0 czp0`< d0h0l@00`FV:drGz΀ L 0 LHz0S 0Pn80v%΀ L 0 Lv 0[4 8 <,10$101000 0 ;81>`0S x僼P?`W YP$?`(  R 1R8!8160S0;% h?u!`p 0!H?u0`0`Sk1h1j1i1H 0HL1S .A9 04 8 <0#$0 #(#< 0 a V*`Jf |~0 00 u΀ L 0 L  0 u 04 8 <0C1 04 8 <(10 0!48<BQrR 0 !4 8 <BQeR1 Sh:0  0 +R RR ӳ 00S0  00 Z0 ;S SS` H 04 8 <$!S0S;S G$1l| 0$1 @u. 0./  0/uG1@ q GG ;SS SS000$10$1;0CSoh)p))p)p)$)`)0 04 8 <CP40CS$t A`p 0 A ` 0  `p 0 t0 48 0 Z000C0S5 P30  04 8 <$!SZ$ wt΀ L 0 L 0  qt00 1 0p !t0x0|$10pG 0S0 [ڄ9Pt΀ L 0 L\9Pt0ZH9@t΀  0 9@t0 ; S 04 8 <$!0CSPp 1S 04 8 <$!Sw000l8 t `p 0 D8 t0 cp0J0 00 0S  04 8 ,x1BQ 0C  0C  0CS70p10l10  04 8 <$!S+ R02 4'%=0#000 .  04 8 <$!R00 04 8 <0C000s `6040F;s!`pas00;S5  S 0 4 8 0ASZ 100#S 1 Sls @`p 0 @ms3P 0 4 80Q: 0; 04 8 <  BR[4!0CSW@5?s!`p 0!5@s0`0`Sk1h1j1i1F 0*F 04 8 <0C1 $;P 08C8S; 0  1 0C0CS103/P;S81,081Z 048<$S{ `100CSvG103/ 0`sd 0h 0l410FS r΀  0 r*0`Fr̀ L 0 L 0 r1SC 0L!4 R8 < P0CSڨ2A+ 04 8 <4!SF}2p1 03/2E \VF10C1g00 =E   04 8 <0CS) 1Va 04 8 P Z -L0  0'S(P H@p `p`p$0 LJ-긠c 0`( "4`#/\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc 0-@L0:0K0h 0-TAX1LPD1A0P ` \1+T@1L01H xPx P0 08 60; S0Ҳ;0'A@|b -LMpW(0`0 800Sp `p  ( 80` 0 0Sl0  S /PW0S ?P@l0S S `d` 1(W U(0Pd0  #`% :l0S(0 S<000 PTK0 Rhf R  a pPE=P PP I`P1U1Hl  Q Q `0<$ %K+"RKQ K  @ j1 P{LKP 30S?P0PPK0P G P(UGPC00 003 t1B YlVD1 S`01 D|0S- 10 PE 0P I4P(UIPC 0010 p |0 p0C|0 *'001匑|0pS0} p(WQ5P2UAU^;S[Y?PW|00C|0 00 00 00AP,0T00 1 l0D?o 2R0SD , 1lPP p1 00Sr0mHdQ~l# `p`lP PP Pp0Sd00@Cd0@0  0 1,(W 0pp ?'K14!0CS)202* 0*+ 0+|b0bv@DbbHbb8bj)8AdLA@\Abc|bbc0@) 0)* 0*~t 0X 0000 1S ! X101 `001QāA0 3SH L0SP0\ 00P4}0SA01<  0CTʌ 00 000` 0 S` l0 SG S| (| C0 P0k0 +1kPP" 82 00S0 d"0 0000 -1 0CS,-0|0 Q} 0R  } 5+R ,# R   !BR`08 T!4 BR 0T0R0S 30 Bk&΀L 00LBk0 0 (  `@` p05 d0ld0 $ (     $_ $ W (  TK4  !  `0 `i!0!Q0$S0P0 @P00S0 (",$("", Q "  "! BR ! HR1(",$ "$ l0Sl Su 0S01p0S14!0 CR141L1S5ЕP0L1j#`p 0#j`+Pp 1R 4!S Sh 8p+P *0;t60 j*0`l0(`S_ S /P&` !0=0 DT  $ (  J8*P4 00 St0 40< ,0 00 St040<,  ~ x'|t x$'xpW|GpGp'tpn8*Pm 14!0 CR41ŧT`00S 8*PK $84h&l|0`&d`(`Q p0| 00 i00| 0!`0P|R1+00 PP2 7P%rP e|0  00P e0 & 04 8 < 40 8 0 R`010 ቆ1ISa5i)`pi0 $`pdi0Sڄ $100! CR01$1x1000 00)0S !<:R 0PSLPJ(PHPFU`dP  q\(0Pd0 p Qr &o  SR``U`VONh@@BWxU{ | 0-1H @0C10L0C0 0R100  o0bc -@00!LPRp`0 0R|mP 1T010p00 0 R 01 @ @! !1bbbc 0-LM 00 00  -l KhAc0 101/ -L4MP d a s`R S@@Q@TV QR QN p  QDJ4 A\@Pp1X0 ` TKb2 PK^2T0Pc(#"$ c$"a8!T #4 a4#CQP0  CQBQ,K$AP @\ A B^,K"@X0@D0CX0 X0@`SALKX0Y(K \1`1q0FS1aSF    #@P a0` CR000AS0 @P 10CSQ0p CR00 @0CS0BS0P 0 BQ000p CR00T 0 FR GQ @GPFQ@bb 0- 0@PD 0LH 0L0 DR@Q000CS00CS00@0CS@0 0-@LQ00 00! / 0 0C0 R 0 C\ C\00C01-S AR 0R0ASS0 AR0; 1 0/P// 0`( "4`#/ -@LPT`HP 40Zƺ<Pf0 L0S01S818! B011Kh'Db -@LPT`TZP 40Z.WHZPf0 L0S01S818! Z011KhDb -L0 BBXdc1M/ <0M/ \6 0-0L(@+R@ A3QR0Y? R+RY/ R ⧀K0h 0-0L(@+R@ A3QR0Y? R+RY/ R ↀK0h\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc 0-@L0  0:00 0-\0@L00SHPD;x T(3S00K0hcddsADbL) -L~ KhV) -0LSp@ S RWT x0S|0S0s0S0S0s`T(` ȀX  0R  00;P 00(0 v/0 SP S\ W 60#4060#400P 00000 0 0 0 000000W0@00 00&a0`` 00 00 0%  t / x/ 0 48 0$0(0,0 8<"8  0"8S3K 1 0K4 3K' 4K,0 wQ 048 #0`0@S410@Sʲ0TT#T1X%XS%!0P900D48ኻs@cd<)c%( -0`L@(]1@($Kk]ꐟc -8L@(`p]1@`p`($Kk]ꐟc 0-P@L啲D 0404 000Ͳ$0$K0hJPdȢbc|bc -L M@Rv0p  岲$K`P  ' P$ 10S J0CS1) N3K08 [3K0 (B0080K7@K0 1( ¯&0Q1;08C8 S; 0;]$]Y?Q<i]%]T!X1 L1\!C1S01P0!01S00010 1S ;S\(\0S010S01;S P ůP =NT!X11X10T1014110L1;S0;0103/^PdПb:)cc@|b -@aL己0P  $Kk8P ;` S HT X1\ B R*1C1S014cR :v\'z\<i\%m\0000Pdcc$b -LM@Qk0p  $Kk襱``P DQ>\&B\+R90S(0Q(0R  Ӳ11' 1S H  B0R"*\& \0 0 B $!  t01 L01 ['[<TPdcc|b -@PL0p  Kh;`AP 01; S !R H0H00CR :401 EPdc|b 0-t@L0S000S=0 0S0 00S000S=00S00h 0$b|b 0-(@LL0 K0hZꀮc c) 0-@\PL嚰0==09#9S K0hѰP 000Pd 0-@LQ8O`MK0hI/ -`@QL ,1`pP01P0.+0B8#8S1 ; S!R0?0$KkR  0?!0!!|b -LMP00`Kp0` @0 $0K\0 0L0 0`@ 0 0 000 00?oP20S  R0 (K -LM2 3p1@4` P W V 2 p02 0 S Kqb @DT0V2 00 P2 00@$3կ@b T V2"2<02 )0SPP(0 pP -K#2唂 2 2S SO 2"R00W0S -KnP @2ޯ (K( 0  02 d02 12 2 S0+0|" x2 2( S 0B R 2 R " R  pR t" ( ?KhR t0l" P dKc"K`2 \K[!K&W?K x0X1 ( 0  02 h02 12 2 S0+0|" x2 2( S 0B R 2 R " R pR ?Kt" ( hR  嗟K\l"  d"K&cK$d0`2 x0x0[K\1K&W?KUK d0X1 0k2 =2 2 =C2 0Gsp @: bPd -L M    0LϿ K踠c 0-LMPQ@ LP l 0K#R #P K000 -LM $ 0 婭P (0S W PU !  P o@P5K Kh@ꠟc -LIM`!Yp V @(K0S\@ R @00S!IoQ㪢 0S0R@ ,1 001 u 00!,@宮,R \ R81 K_K, @P+![81R0[SSl Sy,1[S0[S$1 S QqC RQq8 &@PK!@P\, @@8IKD00KFLP (0S !Y`V !@` 4o@P5R @@S0  1S01s00R R@t@@SR&CK$C,1[SK08 (@j+@>Pdإbc -pLMP`K` @E"00, K0d0"0@\ 0 0` 000 0?oP2@@T`V P0U V 4`坭00  ٭(K|bPd -LMpP`K` 0@0 "0K\0 0@` 0 0 000 0?oP2@@T 0S0 Pa堭(K|bPd -LMpP`K` 000@0 !0K\0 0@` 0 0 000 0W?oP2@@T 0S0 P0(g(KPd -@ pLM`KPK ` ! 0P 0   0  \` Lp 0PoU@@T <)PP ,pVP((K(cPd \ \ //S= 0- \ML@P`!0p,(`00 0P$@ @@ @( 0,p!0(`0 4P$@ @@ @P? 00'4!4?,p00(?(`0 08P$@ @ 0Ο!>,p40(` 00 8P$@@ @ 0 00!>4,p0(`00 8P$@@ @L> 00!<>,p4`00>0(`00 8P$@ @040= 00!=,p0(`00 8P$@@ @"040= 00!=,p0(`00 8P$@@ @T= 00!@=4,p0(`00 8P$@@ @q= 00!<,p40(`00 8P$@@ @[040< 00!<,p0(`00 8P$@ @C 040T< 00!D<,p0(`00 8P$@@ @, 0 !;DK4,p0(`00 8P$@ @@ @0 400!;8K,p0(`00 8P$@ @@ @0(0@; 00!(;08 K0,P$@@ @0 (00 !:0:$8 K00,P @ @ 040: 00!$:,p00:(`0 08P$@ @T: 00 !9,p400:0(`00 8P$@ @0409 00!9,p0(`00 8P$@@ @0409 00!9,p0(`00 8P$@@ @q040L9 00!<9,p0(`00 8P$@@ @Z0408 00ȟ!8,p0(`00 8P$@ @B0408 00ȟ!8,p0(`00 8P$@ @*040L8 00,ȟ!88,p0(`00 8P$@ @0 400!7,p00 <(`0 08P$@ @@ @0407 00!7,p0(`00 8P$@@ @040H7 00!87,p0(`00 8P$@@ @0406 00!6,p0(`00 8P$@@ @0406 00!6,p0(`00 8P$@ @0 400!46,p0(`$`0 08P @ @0405 00!5,p0(`00 8P$@@ @p0405 00!5,p00x5(`00 8P$@ @V040@5 00ğ!,5,p0(`00 8P$@ @>0404 00!4,p0(`00 8P$@@ @'0404 00!4,p0(`00 8P$@@ @040@4 00!04,p0(`00 8P$@@ @0403 00!3,p0(`00 8P$@@ @0403 00!3,p0(`00 8P$@@ @040D3 00!43,p0(`00 8P$@@ @0 400!2,p0(`0<0K 8P$@ @@ @0(02 00!B0< K,P$@@ @0(0L2 00!<2< K00,P$@@ @u0 802 004p,p!B0(`D0K  0p00S S Q K 0#@ ,E@P,0( xQ|Q0s0 00 -` LM$0K0 ,  #0K, Kp@PdP0P 6SU  0)@,P\ QT  ,F@PI,0( QQ0s0 00(@( 0S@ 010j1 SQBALO `p`PO0(;0`1 (@+(111114110@ ᚥ@P  K :E@PT0P ,P 8G7@0j1cc|b -L@p 00`V V /P0S 0S 1V;10;0 VCPPPU P*1`01F0PP PPPU1`0117P`aP1`01P[10 1Sx !PꠟcPP~ aV 1Va(1`CVj)ء)0)H)8)@)@)H))001  GKR; FK ;1K= S01K 1[01K`0`S1[i01Kh1021K1[\01K0 00 H0C0 T11>0 X1 1?0 <180   1 Q 0 $1Q FK0 10 20 0 1K20 20 111*P@eA|bxbXd 0-;L@S ꜣ))))))0;@T> ;S 0S (P  0T;/ 000S; S !R 00?0  S0S 0S P00 # P ,00  P @|bbb 0-0LPS(@@T(@;SK0h1 QK0hXz!@P 0 0-LM0K K   # K2@PWP nK0 -LM0K K   # KP?@WK p-LM0K(K( $  #$ K`@P (PP =P  W@9Kp -LMQ0 ` (K 0S S1p11@11p11@1P0K` 0 0, Kd" 0 0\ 00 000 00P?o20S0S* BR)4)))))P)t))))))))))))4)P)t) S  SX SS0 0S  CjQP1P#US  ӖCjQ@1@#Ṭbbȣbģbbbbb ( -$LR  KhLYBAoAtA 0-@\81LP01QOP34110#`pc(> K1M  x̱c 0!< 0`4 0 (   !/ b$cDcHc -L@jp@P@`aᡅy噓Pḏc -L@PO`101῕ t͒ c -LP`7@; -LP`)@B 0-LP@0 -L`p@ P[@} -LPp@ `ეPP#h1S/:db) 0-@P`pDML!20 00p,P(`$@ @@ @5 0!x20 04p0,P(`$@ @@ @ 44 0 00'!2 008p0,P(`$@@ @P 0 0 0!1 008p4P0,P(`$@@ @P0400 0 0!p1 008p0,P(`$@@ @P 0!(1 00 8p4`0,P(`$@@ @P0400 00!0 0008p00,P(`$@ @ 0!x08p40l00,P0(`$@ @ @0 (Ko6ꇚA2Adb6AAAxA̱clm) A)y7B-\0 \  Ĝ   䊐  -LlMD `(< (<0SP *d0K ʰP  d0 QP%P *\bNU (< `p`(<(K P P 0 4 p $t"$x'xW (<!`pa(<Pd04!48#8S A0 4Jp! 0 K4 8KᴨK |p xp  0pK4 7KᴧKp0lp hp 0S㈐6 opʃpP/7[([p0p0IP(I<# 0(#J<'[p\啐P 0 0R:(0 K p  P spPUGPl 0XP H0K P\ H0 QP%P N:UP 00WSu bK?\K ⴆK& 04FK 6K3@K⸄K& 0dK`44KH K0KpT0(P\* ;"`pbG0S&7[Rt0S p Sx0S S &8[R (0 K (0p1 P ;"`pb(; P0FP ̱cA 0-LM0S'0S$P"0!0@S P% R \0 Q@ 1 40 04 H8 <$ōK0(0 0@)̱c%( -L M 0p0P@xX` X /@0S  ᜫ@ K0S  SW @0dS*@(KP@P(0S Sd0<d0C@P@Cf1-@PM_1.@PNX1.@PNQꠥbA|@ADbԡA -LOM(P( PEK⭀0P,1  1O `pU`/ `p`/,11 @P@K,0'S (tP (10<1 K (tP 1 Qp%p * AW  <媡P(1p 0(!: 0PH1  =0S PK .`'H1Pt-0p0A;/ @`p`@2/B  0 0/`V OV 3V V <0S K . R' .\KN',1,20\0K00RA0SpNV V,11"`pYb :YpwVV:U,1V1 '@PG ˣ@P( SFV Vg O:V{ V,11&`pYfx'U ᬣ@P( ,V :0FSK,A0`0 0K0 ( %P !00Q:00S * `p`*K,(KP`041 ,V0} AVC +Va 0a 0X@(1 A:cbc<* 0-LP @t{p0 R Q L@L0P@0K0h{P{ K0h :cbb -LMlt@Ph& 0 i&0`  V& Z&j 'R 3SH0L0S(1@PY  0  RU XU  $ ( ,  $(, $(, $(, 0S ,0K #) Z-P240:S/ 0R0% *00K P 00 Q%*t7Q % @P@%(K0 #0C?o23 % "P %!(MQMa4  #RH L0S0P  0~@ 0H  0C/S000C00000T 410S (1(!(70( 0 (  /R0}@P  3SH0L0Sp0 80   80ou mu(P) 4-0 8.00, / 0^%PQ `%(4ocAb@JA -0L@'Sp`(2@PP t P tP 0 $Kk$Kk -0 L|c -L0M @p048 t2`PQ7P(\b\R\z X 00SS*0Rz$Oz >K+28K4KHK @P  ~tPHK k$Kh@K@P 400D K  0 @K㟘P ؒdy@T 03/@DXP XQǒD@y ỔpzWT 40 %0&pSR000S H0! R 0QP \ 0S\  0WV*Hu$B̀# 0#v$fb:c*c -LDMp50SG 4H@KH0 0P0  HKD 0 QP6 0S3 @P07PP+ I0 @@ 3SH0L RP\0 0@ P01<#P0 90P  00P0S9@ \P9ՕX ѕ`T 90`TV 400 0S 00S` `` @0 :  000  T0  v T0( )0,0-0.0/040 V  0o @k  QPPp 90P  `T0 `0X0 P0SnX在`G`(`0 P0V`C`V(0FSq*FA 0a0`ppG(pp(0p(p)`ss0s@s(0:( C8*`#<4+`8#(#<04 8( #8 * +0``` 0@PC YC 1)@PI1(@PH1/@PO0` 0 }6 0P01Q0R09 0T 9 F Bxpz0q0cRQ aᢑ(``X Y0@!#F `p`$#(KLbc 0-L M@:T0 p@PP P@  R 4KL@P 4KK0 RQ@ Z*@ -0`L@"1@$Kk"c01,!,"/ b0!,21 ,/ b@-, @ . @@,@   P/)m 0-@LP 000 0-@PLfK0h 0-P 0L#$#"$#"4#  B0 AT06 TP @ 0-L@PP ݦ0 0-L@P ѦP00 -@LP` y<0400 00 0q@P  x4@iA -L4(K0x0p0嬐 H0cXf ,19 0r606H RꑚAAN*\ `P/0 !`8 0 0 (  , !/ b$cDcHc p-L$MP@` 400K4 80 080K  ~KpA 4 #4 # / 0!< 0`4 0 (   !/ b$cDcHc 0-@ L @{vK0hNH c 0-PL@P \EP 03  :PK0h۟K0h觕@ -LMp60@TPBOD`P` `P 0PR`U V 1S BOCTVU@@8Kk6U UᨕT 8Kk K cQ@- 0AS Q0B \ R@ P R  P0Q 0R 0-L@P0S 0P SP\ ɔP,00,00PP0 -LM,0P0PV 6\1p@TBOD26 㧔,00,0PC0S 0S  |P AT BODT` `00# d d00# h h00# l l00# , `8Kj5 i,00,08KP K c -@,0L `0,0$]p]uQU 0S   u GugpIuP 1S! 1 ! QFjX}uP 6bQ0@ 4㚤`$0 1iKhc@;c -LEM41 0R01 @0AQPP`p(Ks -0SS/pHQT6Q H0PPEK, 1[S`KC?K K loP 0R REKnP-0S3:0S *2Q0 X \:0S P*Tx0| RS(:0S  .K0K*1TCpT?j@P7p 01X00959p /3 P000000 11i9 /H0S- 0S$ 1崐S  YP $90S ` .K0K)1WP jMp P .P H1[S  CKP vEKhq 0 D8Ѐ 0-q 0 8Ѐ 0.d0 <Q00 00 tP 70S000d0007 .W htZ4L2 SD0Cp4X ItP W0 -H0QS D0CSU4XX H0W40K 366(0HP W a!jhspd0S BS=SC/ 1B p}hs3S$ IK=P( o0 0 X5D0J/KIK.EpP'50S I/K.K(1%0000K0(qW  ap 1S B?SC?1 1BSC/ 1 x cs1䤟S01  qsğpKܠ pK  mP( K6P  P- ,4 `KQ0K\0 X0X0 H0 <4 KT `K 80 ُP( 0J/KDP30S  .K4(1#0000KH0U  iHP hr1\S01  3sY <3@#0K<  P 0J/K|DP20S  .K(1"0000K/ Ki?iku(ijuP iNi0iilLAPi Ji(eiHi%i i i i ߖ>Si Ii !i Ti YcYcjc -`L MpfPLBp0 TD@DT UJL2SD0C0@! ; R  R`H@T D@D}f00PUP y`YP$QPQ P H0S D0CSUVPP(KUP \P b -LHM<0PS 3A0AS`,LBT @q@D@DT  -$"XL$K00S0hKa ,0 000S(lP$ 00000S ` .TKT0K )0 00S,hKaH@T D@D0㾕|b(b@;cb,@A 0-@LhK0h -LLM@喛W5P},LBT `pD@DT,. K00S!hKwa,S00S ` .TK&T0K T0)0000oL,hK_aH@T D@D@;cb;@A 0-@L1K0htQ Q// -L+, 10S@?CP4$Kk=,!R* 'd R QR :X UXYT*R QR@1:@T QT:@@2S ?CS ,T0@db -PL` U@P@ NP @ -8L Q Q Q Q LD'0AS@GQ #Q 5QQ Q Q궧A -L`aPaa@d0 00 s0@0L0`0D00@0 0<0(080,040D00040,000s@|O*tP*O*\R*R*N*N*M* -L`@(t0DP0kCKkkaia ZdKhcaPd0008C0 04 8 < 0/  0-@PL !>00000#800 0-@P L@000000 08C0 04 8 <00 -L$M@0K0KK 0-@L`P aP0 -@L M0QP`E 'Rh 'RX'("($xpt <K<K,K0 Sp*00S-0  0 0 0 0 1 0 S00S"1000000 KhɉS000CS0pS000CS1 ܧAA 0-LM`@P K0 0 P1K  Kp|X |K?|K⡽ K|K⭽|KK׽ K0 00KPpW> 10S !0' * Ku P0S P :*0@T BODT h P@ AT C*T KJ$K00 00 @b@2A@ c -LP *LbV@p D0F`@Sp*W @Op/o"\ R\ Q0! (^ R@R@ ` H0S D0C80GS SVT#SB (S S0F0 8AP  $;P V @0@$@@@  'P GS S %SV000 00 00 00 00 00000V0S  R000000GS S~`ꠣbb QRp-LMP`0=0 CP.P R C?RK K姫0[ K0 C0K@T'X tKtK} KtK≼ [KtKⅼtKK⯼  X0 0<00K0_ ]c`KpA DR @@Õ -LM8@Q :0AS 1 0 001 000$Kp$dSR 40S $0%Q Q 3  h40S 0X$\1 0 0;  LK5K0L00S PKVP1` R S 0S0S0S h0VP 0x0V `P0x@ Kإb@ -LM00 0 0@Sp P(K0S0S/P0S" 0S(01S x40Soo`b8K0l`K80 (0K!0K0`0yWP0S100 fPd0 K;KȀ Ā 尌KF 0SȠKQx UKwXLx0,*[S |0S0S0S 0 x0lK`KPcH0[`x0S|0S 0sS0SQF x:[60S (0K 00Lx0K0 K8KP +d 00d000SP 20`( "4`#d0 dZ2X0S100 sw =P P1P0Pإb b$b -0L@S`(P`pt0S    0R, 00! P yP @jS8\x,$yἒ@0Kh\@cPd  0-@L06:d 00d0(010K0h -LM0@SP0S0s  0$ K0"4Kt_40K!T$KP:`01 ^pR WUOQL`JW"^pWUQ`\p`5PU P@T*0P050A%@Q Qp`pRQ'"0Y$ R Qp ! Y0W pRP'p5 W0YpRPpp5\0YP: 0Ypp pRpppNA$@ p-LV0 xrPPrPP,E") 0 )$V 0  0 0 0lKp KHlKp t QP HQp00t0 4 |V0 t K|lKQPt p0R0 HKt K|HKp t |QP HQp00t0 3p KHHKmQ0P0 t p0Rx0H(01K R 0QP \ 0S\  0KQP#^ ! 0!Vk H0!$\ Q\:\ Q\: 0 R400  | ^Z " R9 03,00 HPB3|0hQfQ@0H xK+e0P" 0 [. \V0 (S 7S 0 .P 0 & x R 6  0 7rP0 H0P H R !  0    # 0 # H0S 1$ 0$0S $ 0$Vp 0SiVf|pzꛪA:cAAcA٪AHbc -0@P`pL00 0 09) 0 0xpf`@P -@Lq4P0!0c58z0!0c5<u0` 0c5Dn a5@DPPQ ^pJ`PDPAQ PU @0H,P00L000SP0EPS0PYc -L M, 00 R*000L ?R00"040 004 ,000  S:0p00@4D`@PI 040S004 40P00,0P00<,P HB0080 0000(KYcb -L4b -L M    0 e Kc -pLM`KP` @x0K\0 0@`0 0 0 0000 0?oP2@@T0 S0(K̥b] -L M(0@ R`p@ K(0K m'P[3T( PPQQ0SumPU@m0 000 3SH L0SP0\ 0nP< 0CU*0 mP -LLM)0 4  0p> 08P00,($@@ @p`ᰧ8> 00!(> 008P4p0,($@@ @ᛧ= 00!=4 008P0,($@@ @ᅧ 040= 00!= 008P0,($@@ @o 040D= 00!4= 008P0,($@@ @Y+040< 00!< 008P0,($@@ @C,040< 00!< 0<08P00,($@@ @p+ 040L< 00!<< 008P0,($@@ @040; 00!; 008P0,($@@ @040; 00!; 008P0,($@@ @d; 00!P;4 008P0,($@@ @Ӧ040 ; 00!: 008P0,($@@ @ὦ040: 00!: 008P0,($@@ @᧦040l: 00!\:0<0 08P0,($@@ @Ꭶ040: 00!: 008P0,($@@ @x0409 00!9 008P0,($@@ @bx9 00!h9 008P40,($@@ @M040$9 00ɟ!9 008P0,($@ @60408 00ȟ!8 008P0,($@ @0408 00`ȟ!l8 008P0,($@ @040,8 00ȟ!8 008P0,($@ @#0407 00!7 008P0,($@@ @ۥ&0 400!|70t7 0<08P00,($@ @ @¥040,7 00!7 008P0,($@@ @ᬥ0406 00!6 008P0,($@@ @ᖥ0 400!6 0x608P00,($@ @ @ဥ040<6 00!,6 008P0,($@@ @j5 00!5 008P40,($@@ @U0 400!505 008P0,($@ @ @<'040D5 00!45 008P0,($@@ @&0404 00!4 008P0,($@@ @0 400!40K00 8P0,($@ @@ @0 (00!,40K0 4 $00,P @ @ߤ0 (00!30K$03 00,P @ @`Ȥ0 (00!3@@030 K0,P0$@ @ @ᴤ040P3 00!@3 008P0,($@@ @ឤ0403 00!2 008P0,($@@ @ሤ0402 00!2 008P0,($@@ @r040`2 00!P2 008P0,($@@ @\ ePn !0@C!00@ T!A0^w  _1AJ%s1^|slp1(KtAALbڛAHbADbbA8bAA(bA$bKA@bZAgAvA bAbAbẠb)"Ab.AȣbIAģbTAbAh*AԥbAb˫A`*۫AȥbA4bA*y7BإbAb AAD)Al)A)AbA b&Ab4AbDAQAh@.cPbc+:cd :c R RR CAQ ,0w -0L@0SP S S `( 0 H` (00S 0  lc -LM<0 P<0p0D 8 )S0(040K (nP 4 0Q0%0 * S B `p`.0 0⃑(0R`%(`" *00K (nP 00 Q``V `@ 0@0 I R :R R> Y *  Brp(KY A!`paWlY R +0 0C  D04 K 3 K[$!$("( IY@<0@  80PYpW   \( 0 (^*0 0K0 0b"!b! 0 R B( 0(C,0\0Q H8 0؈ 0(4,00C8 ꧝Ac -L$Mp(0P@ ` 7@00`SMh0  @K@KJ2. 00 )0@KUP@h0 0,K/ 0 )0HP@h0  0,K4 8 <0!c#!$c4"#:0 = )0/P@h0$ 0 R (`P |A `p`(K00Q {k)01 P@qkh0 (0+Z Z `P 3Z0H0 S 3Z <Z+Z Z Hk3Z <Zh0)02  H09kh0 )03 čP@c -RL$Mp 0DK(@(0 DKHP)0, DK⥍`P P0 fP၉k K1M  B -(QLM`P 'Qtt 0(@pTDK 0K Ig,W [3W@ p[@ZA p-L,M`P@PDD 0 (0S+R8 R5 )R 3R <R- ,R@S:D0K g4[<SUD0[0 Q'SD0K( g(U>0[0Kp S:D0K fUC[D0[0(0S S:D0K fUC[D0[0@{A p-PS0`@L MPK0%0PT @@Kp 0-LPk@P  g@P g 0pk -LP 0-L@ckP0K0hg (0-LM0 0 0 @ 央0  R P @`p`@I' `p` RE @: ><>0F `p`=T 1 `p`) `p`-0& =(   gjP #!`paT 1 @P@(K2S# # 0'S(i00`S )`piTe 1 @P@^0SK  04 8 < $ ( ,! $" (# ,%$ $& (' ,+  $ ( , ČȌ̜ČȌ̌| SČȌ̜B! Č"Ȍ#̌|*`pjT 1"@PBAirP 0'S(diP W 0 P\KV e `p`f0( KiP0PpPGP L*@PJPBG PF PF0P0  :200 0S-T 1)`piP9`Vp@ `O+ 0+$ 0$T` 1#@PCP9K0 00 0 0 K0Kg0`Si ΀  0 V 400SH080SL0 0;00R 00 p0S# KP5  P 'P 0 QFP * 0*3 0 ̧$4"48#80 XĀ 0K KKKP~ T 1#@PCf,2̀ L 0 L 04 8 < 04 8 < 04 8 < 04 8 <  ZK┿6 TK5K  \KC   0Swh60S  .\@KK| .x@0K0&0f660Spp #$ 0$%T@ `J`000jP0 4#0S XU( 0(T 1# 0#1 @P@0 r^0)S(0\0K (iP \ 0Q0%0 *y D  0 >S 00 0s \40Sp0(( AR*T  0 Tu 1#@PCn(0Q Q0(0 C d0Sa30S P dCe$`pd3WG 0 S0  $ ( ,  $(, $(,r  $(,0 $(,(! $"#0(<sB* 0*DT 1"@PBWe40l"% 0 %$0S 1$ 0$V me`pᄡ儑0S  S  `p` 0( 0R `p`Tg 1#@PC`0+SW T 1 `p`(`ph0,SV`p, 0K0咑#  0K3/L0 PS Ccdd:cbb@ALbA,bh@R" $ ( , $ ( , $ ( ,$S 04 8 <! 04" 8# <% $04& 8' <40 ;0\K0 K)XP Z @@P@@]KR -LM@pdIYPPIK0KBE`Pe100 0K4D0K-DPd:c -0`L@1@$Kk c -L M    0Y Kc -L M@ I0 0S@ T0 Q00Aᷳ00(Ko=I`娀aPU pW x0S 0CSx0040 eI?40pS 0#00C000;?`cPd|b +ccc -@PPL `0 DŽP M ᩃك\e\ `P/0 !`8 0 0 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -L$MP0S4@s0S/ `08K< @0 0( @ K@I@ y0C(@DS0 K P0R H8>00@ R0C8#8ꄥbc@2i c -LtM7P 0 P73 R ǟQ"`p0b'`p0Pg@(K`70S 7S @@@0( fPPI 0'S 0 3SH0L0S(dPP7 00dS lS3 d@0`p000* \ ( Q# FK0 X&0$K 0dR lR 0H KP%7@<`p000@Kp겠`@K( "KR6`pbhK`p0&0&K0 hK&  XKx K hKA@Pt K XKA@P; TJ*`pjNM`pbhK`p: 1<02 8P#8sQ ##&3#p KhKAP t*@8#(Ql KXKAPx p0Rt l0R"`pb#hK`p0 #3^ H(p# 0#_P #0 00(00fP c01 3S4H0L R0P0AaW cP (p(pph2Dp @KH0 0,0p 0LrH ᲀ 2H K P%IxfpP n0'S 0 3SH0L0S(dcpP 0<02SX24K0@!F0K0E0KH0K000D H0 @`K 0 P 0' 1$\ Q\:\ Q\:(  \ R! 0 0H0KH00S 0bꄥbcccdccb 0-@p`\DML!0 000,p(`$@ @@ @Pမ 0g!0 0040,p(`$@ @@ @ l 0!h0 0`00080400,p(`$@ @ @PU80(KtAA+y7Bc8 0 R kR "} /-/ᄥbxc p1-PLPC 3C7CPQ 0@!@0#0#0#$0#(0#,0#00#01Q.pBaB$V V( &#&$'$ [P $UP0S `P0 0S @03#"ku(cbc -L$MLQ@p 8#8R$@(* sWG@ AQU.@ T+d 0R .;00@@@(K8 #8`V  0@KD H0 x00 H KhF@`V`x;Paq; `ꄥbccc c@2i -LM0plSP 8h R @8d0CS+++++@ +x!+H!+K&}@P'1S 00:S0S*@7 R WA+,WGgp7p'W0Q0Ar(KQ@ K|@P[?Xs0S [P@?PP 0[" 6RP  f303;[20/@0[ 30P""##;[ R00Ƒ3SuH6K0 <6@ p@  K(ME 0S @ K|@P[\ K|@P| 0u0#x Q0#t 0#d 0#` 0#\ 0#X 0#01 A@P@APZ |0PP%x0 @P%t0P%d0P%`0P%\0P%X0P%P0a\ KP dK$@P0S  K׾PD dK$ѾP>0S;  T* K.@KKd K.00$@05[$00KKlK5[P RQ@T ꄥbcc -L|MP @R 0(K0S000CS B 0 4 8 <0S ppq5P<"  </p0S ppq5Pp  p @Pppq5P@  @P 5P 58P 5<P 5pP 5@P 57-  0/ -`LpP"X@P UOX0Y7VP  γ@ -0L@(S`pXPP[7X(X( 0(0C00(00@ 娳@@ -LP@U`p ^P 3 0 P$Kk[ 0-LM0@)S"0SPP PK2wP 0 :R0SK0 00:S000 Fv* 0-@L00t0x0|00 q-``q.QL@PP 500/U00S00=U00S0t00U00S YP 5001U00S 8P 4080#U00S <P 40<03U00S @P 40H@0Y2UPPUpP 40p0 -L MP 0@p #0H S"St7+8+8+8+8+8+8+8+8+8+8+4+5+6+6+t7+7+8+8+8+8+8+8+5+8+8+5+<8+l8+T @/0S 0S 0S 0S0S @T. R  R 0S0S0S 0S0S e@9P{@ Kv0S  |;4P7@PT0 Q0@T0t0@T0  R0 00PT0p T0T R/@S0S 0S0S0S~ 0S{ 17@P03P #0 00`P@T16 TY 00TU1308S  0 00PT T: 00T6#X<` 2Xp``30T%3ST0@ST@@x0ITR0 R000_T0 R|0W*@2إb -LM@0PS`pm3P7 N0ES* 0 00000000K -LP`N3@P 1  P c3@ 0-@PL0-K0hU3 -LdMPK p`u@P 0S)0S&|0Sx0S h1$ @@0P @tP 8P@8(KsV 80[S @( TKϰ0S%0S"| r!.p x h0 d0 l pKTKWP@TKWP  H0 x8TK WTKWV  xK0hKl p0 X  b -LlMpH S@  )S *P `FVP P PRWP(KgVP, P P 00F;Sd=+;+;+;+;+@+@+@+@+@+\D+;+;+D+;+;+;+;+;+;+;+;+;+d=+;+d=+;+;+;+;+;+?+d=+d=+d=+@=+@=+@=+x?+d=+;+;+?+d=+?+?+?+?+;+;+;+;+;+d=+@?+;+;+x?+x?+x?+%0 00+PPKCtPP&V] &V` V> V6Sx0S|0S0S0S h0R99% 1$V* %V h0R88')V- 'V$ (V| h0R77/VK 9V0 +VpYc h0R1 1h0f0  Rl0VO h0R88h0N h0R77 h0R66 h0R66 h0R33 h0R55 LKsPP* :0LKI!KsPP0 K 1P sPP 1|0 &P`P` U 1PPm 9P`0`0000 0CSx@+HA+A+A+ C+ LKosP `LP|  *6P| 0)3S10"|0S200S@8 0R;0S8PU5r1P1LKJsP L0  R00 s800 K)sP 0S0ŕL8!,21,20|0 0L K0|Kx0KP  Pzx0St0S p0s T |LK5y|Q 3S100 xK<5P`|pV0 KxKM P 00S0  000S xKkP `hK rP oh0S d0S`0sT aXP|  s5P| J |Q 4PI`|VE Yp 0Y 2P| `X\36D`KH L0 5LK4 ?4P --0EKrPP0S S Sh04h044h044KnrPP$0F;S񟗶E+;+;+;+;+tI+tI+tI+tI+tI+E+;+;+I+;+;+;+;+;+;+;+;+;+E+;+E+;+;+;+;+;+G+E+E+E+E+E+E+G+E+F+;+G+;+G+G+G+G+;+;+;+;+;+E+G+;+;+G+G+G+%V+ V4 V" V2 FqzV& $V60(V &V 'Vh0C9 +V 9V! )Vh0:h09l00 h08h0C:h0?h0=h07h000h0C;P1xP 9P; 2dP `K8`h0 @L0K hKPP U0x K@APTU"2x RLK x0  x000 LK300 0#`Fx0 h0 VH+;+;+;+;+;+;+I+;+;+;+HH+;+H+H+H+H+;+;+;+;+;+;+;+;+;+H+0I+\I+Q Q LKdLK pQ t0St!KQ8 QQ@Q<Q pQ QQxK xQ 000|0 |KQ|hK V0 V V-PS 0S0L0  zSL000S00$ 7PW00 @b bإb 0-PPL0P @T00 K0h$/ QP-LMPp@`$KU0S0S P SP SR#00)Q 0 00000 000B0 p0 B P -L`pFX@P00'S( 0z4 P8 <& 04 8 < 04 8 < 04 8 <T1 *@PJ-PL @E0S *`pj0-PL1 %HQ0K( H H1V\1 @0tSH0H1 P)0s0S0S8000D1K p80 0 0S. 0R/K0=KKPP@1KH02@.048L8     R *88b 4b4#0#$0 #(#< 0V 0SK0S KS2P@ @X' T1P00T`1 0S 1%@Q $LP Z C*PPLQ K K50L1 KHQPP L L  FK⮪M/K FK0PE褆KK⼀ @0P: 41R6 BK┪M/K BK0P+KK⠀ '0P! 41R3dUb1S1S1S 1SV  ZK 5TK5KF?K:X \K.PD ԀA  TKB?K\K .oᨂX@X2 <50S F/K.\K5%141x00\0K&`p 0&Z 1%`peX1PDKRL i0Z@1S 4  Q00H10D!X1 0d1 0Q<0=<T0 1) 0)3STS)`piWT 1%`pe3PPl 0S 0Sf X!D0Sl 3i0S00Sb 0\!S@H1S@ 2TKX \0 J?KK?K \K\D PN?KO/KXP @1S \ePUy<1 ST1M <<1 //0S ( ,0K0 #KKQ/KKP$00 QKCPD1S= R `p`1`!0S R D!;P DQ@H"PH0KP/PK/L1S K /t (KV x0S 0SV x0S VT! ( ,0`! <  8!R+S  R8 1`a R 0SR :\ 0S\  0WV,<1$ \K,1 媨K?K@0 \1\ KJ(P baA@bb@AcbhbbdcY 8!R>00CS0 0*0L0?0)#3 0@BT ODPd|bv+@ddbMbP/" p-LM` PL2@S7 P$D0CSU0 8K"\ h@]T8K-  }@'  R@ !R R r ЀHQrP ЀHQPH0S D0C KpYc@;cA -L,M2bRB0 "0— -p\ЂXT@ P  pR @0R0\ |P Et2@0S dBCZWP8H\0rP| 8 `r ЀE0XR 0@ Q@K UB_E,"7 r0 KL0CR)*@T @@ , 9Oo B , p , P@K ' / ,T@K@  |@$ KL0C\*T U R Oo B3 q, @ ,T@K uT  U( \T0,(K|bb8dPdv+@;cYc cԥb 0-L@P='P0(0` R T`@%08d -L M@8@0D Q #Q0`p0x WV``h \0S,P  C@0 0RKh/R S`lKШ@ͭAb -LM400S S 0  K0 4 Kb+ -pPLM00 ,00 p C[2p X[0(KWq 0H0ZlH tKtK tK%P l K.K KX0X0 d0T0K80P0 <0L0 023K8 r 0 E 1 R0P0 1 0@$Kh0`PS@K80 \0H<0 8U#8H tK3KȠ 0`V0 K0 K %P  . K KL  KߟP@`0HS 0@;cbA -L4MP@pppZ0XPUZ(KX+ (0W(:` N00E%P  .\KA\ KhL0011\ D0D  \ 022T((@P@;c8d;AYcYc p-LM@ZZP XP\ 吕0⍕0000x0x 0 b d OPP  TTbL`0D ⇕04 0Kph耕8d@;c@\Ay+@fA|bv+v+ 0-LP8=@100s0?0: !#3 0?000t00S 80S3 #00H00S 380S000W00uMbbMfSU 1:VZ t00SXP XRHRU 0UT00 0ꔥb|bLb@;c -LDM1P0@p@ ?2(K` 3P &0 &R 9 R !`0 k`0RR @P0n [P -@P0c .\K\0K,",o?708#8S06đP0SPp 0 Rpq(0S6ڸ1v0W#Y@ 40@A%06S)W'061\!0 0 L!0!#\K@ IRp0 `0Sx 1ysPH0P0? 3R`0 3 6S 060 00 ?d6S 0606T0$ L00 ?T6ᬠS9 R !– V@UAb|bMb80#S S S S /S SS S/ -LMHP`@kVp ,PU x3@K` 0P 0L#0H4(K 000` 004 P V V 3S0@K02 0 40 0 0KUPp2p90` 80"K HP0("$K;0`V0!40 30S  0 0 H0S:8002040 1,0S|10H0 K$pP L1,0S @10H0(0L0S 9KH0Sf 1fa40 3S0`K00 0 40 0p 0KP0 K)Pd0 0S PK ._0P 080f@(@AAܯAAbdA -SL MpP@*P+ P@% P*@"`U@ (K6/@P(W 0P!P(  6/@P ;@( K`@+}+ -LDM0PQ0``0  0SPVU0#V 000@T Z0 Y1U pWpD0d0 0X (K `创P dh0 !Ph000 p` .W4pp\K\0K 000@d*AEA R 0 00sdd 0-@L4XK0hwP/_ 0-p@LM,PKq0e`l  |0[pSI0V 000  0 \K0 `P .Kr0K { I`0S"a00S80%S (S S`KsP P1t 000 QW <Z W (KGS SL dsAA -LQM0` @ K H1 yH1KpPP H1X! t70S @K .H1`K. 00P0,', $GC `p`k 0R|0K  >P |0 Q?ZFK3 `p`(K0` d0Kh0l KP01[S 60S .K.K0K%@0T1 00W00SL1  50S %| KD|KP \50S P%dK <t@T" p@9q 00S 40Sr .K.KpGhp90$00Kod KP KLq@C/KKѭP! 0 T  p"80K p@2F  CK .K.K2 K= 4K}K0 K P30S!  .K00#0K  K!pP 0\1 00P1 6SX1 Doo9 bR`VdT606T1S* 06%0f @0#010 00P16L1 @FX? 2@ K0 0@ @0 K0H006t2 h20 ?T 6 9 ]P00 `  R Z9 X1S 061 10 ?z4NL1S M +NVTN Z \1&?oR20S PM@0 P1 8 (NP16T2 9 X1 &T1 S&X1 06%0 1 0 002  060 x00 ?l00S@0H1 T1Sꠥb6@۰AcAA%AIAiAAƱA|bb@;cLb805S S #S S ,10/S GSS S/ -LM0pS` ( K9@6PP 44 @@ @@@T@W60R7(K000 `````` `!`"`#0 0 $ %##<&'0 %P[ K8F: `3`KⰀK0 00K  K 0PL # R  .\K0 0"0\0K K⑑밀K50V 0 0S0W<002;K0;K@00(00 V@@000`00:0 00 0  őYX` ἫP  ⴑx0`(000 )`,`-`.`/`姑YO"P 9`(0  ``0(00 00@30a@0A`9 B≑`($$ "$ 0( :*`+`W0K* +00Y0`` KW 1(@PH1.@PN@E `p`K,8(0 0(0000B0 @  A  B dbC@ԡAc -L M0 `@003pA0ASp0A"DPᄰP0`  K -PL8M@T` 0` ` .LK⧿ 0pL KSh10`LV 7K ` .LK⎿ 0L KS01 R 00S 0 0` Q 0 1 00w0 00EP00S `LpK` `.Pp0 ,YdA*A%AbQ@^A|b$+A -@LM` ( KⰀKp/9@4PP 3 @@ @@@T@{40v46(Kw0(000) l0S YY0SX p 9(0  0(00 00@0ɑ@0A9 BF*4 40#40'4,p-0'8'|.0( 0:/p*+ 0K* + 00LV 1(@PH1.@PNAwF @`p`@zK60S90 R00 00[S0V<002;K0;K@00(00 @@000`00:00000S0S0S  R 00 40 P*@p ȏ0嘠K 0 KK 6 P0 0  0KK¿P; T00S .\KK\0K0 0TKw67&dcb_@ԡA -LQM`@ QKM_K≏ ᅏL8AK0L1 `P @KfAKy 7# 0R0|0K  9P |0 Q@h@TG AKR(K IKpH IKF0PH1 Z <70S @K .PK׽ .ӽ000 0&@D1S@1S<1S81S 6R01S,1S(1[S& x60S l&td6tKQ_K|0 x |Kd P60S  .K⑽00%0K$1[S50S %| KH|KP50SR %~M 0xP4 U8P QA|b$+d 0-L@L9 IPP,K0hqnK0h d 0`( "4`#/0!,21 ,/ b -LM#S Q pp :s@P P`@PrD 0$K0`@PDꠥb[A@YcP/ -@LdM fK JK .KT0(K3K4K6K0L0K0 KhK6P 00C00$0Kĥb -LM\0P 20S  .KѺd0"00Kp@l2p`V3\2!,21,2 K@P9LBT@ D@DT 00Sw H@T T%10S  .Kp♺pd0!00KKV`\0 d0d RቦP $ Kv<1K,`=K(0Pll``0K 6P 000\00\0K  (K00S  .KL d0PK\K .0 C K. ?0p0` Pp0K 8AKq ꠥb@Ab bAĥbA - L20P 6SʷFF 0S- L S 4S SXA 0-@0LQ 0S  ░P4 !00 0-@LT  0#@<0S P 0\ `P/0 !`8 0 0 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -LM\0@10S  .\Kⅹd0!0\0Kp$`PK x (0pKx0K K | t ` 5pP9\08!$0\000C0 1PU(KU& \0#d0d R PP a0P R .\K0 90  000000d00\0K:PD00S  .\K!d0p0\0K $&ꠥb@wAĥbbA׵A -LM`p @ K ^KPPo 1Pj\20Sf Y D20S @K .pK .00 0"AC !B1S0S0S0S6  0R|0K {4P |0 QPPK08K4K5K7K00@ K@0xK\0K3P| 0000$0T P `VULbbA 0-@L,cBh00CSh0K0hB@;c -LMP p@ K K~UKXdK0KK 8Q  Ph00 0 Kg`P ,20S`(K " 0T  000 P 0 000 0@T q0' ABODT  K`0 _P0X@L10S @!H`8 BQ03 !0A 0  S0!@t  B 쀟 @T3!D    BR !40 00 S*H0  0KH0 7`PK@ȠP @00S 4 H11h  h x cb@hAĥbAYcdA 0-@L|0PS00S 1K0h,+ -`QL@ 0aV00SP $PU P R 0 0pWU 00CS0 h Kh@`Pp 0TS   0LbdbA -LM0nK p@P 2 92K Py 101 \Pr 2X! P?0S oOK .´2PK. ἴ0000/OpC !`pasL1[S1[0S >0S  .oK⚴o?K."0 R200K K0P 0 Q@8@TN7 `p`:K _(K KEKP =0S -k KJ- 0P( T 0X 0KpK\20$2 E0U0K0 匐 $4"40-8#89K00   =PP10S 1%Uä10?0!!#3 0<00 0 00  10S ! S!0… 2. oK0o/K@01000  5@APPi i[VHP`VD @ 0S  R $(  P@*P;0S 2o_K. P0$+L R @ A 90 00S :0S .K.oK@D⦳@90*0o?K0[`09[100[V R*0 z`V3`000PP\:0S Sڲ9[S 8: x:0R I+C "`pb.(`P{ ( ZKP>;X`0S 0S 0) R $)`J0a0S*T0S( R ( 0S S00S 80S  .oKo?K(K?K0 (~K0 , 1[ 031K0![2 001K0 1K048  04 8 2 01 8@T1S 1[ 7 80RʌG哺C̀" 0"ᔺ0,!R @ 1[d RŞP 1[X  X X00X0Q 1801<0m6 %1[ \0pP 60S  .cK┲p0&00d00c?KU`0B1[G !1RC1L™2 "t6\DLR  4" !0 p " /K(&D2 1 ܥ0" <&H2   " "r  @" \0W1S ᰣP0%  U 0Sx5,A0qSpT@PC W R8(5Z4 T0S00S \0`0SKL2SD0Cc 0S H RD BQ@ Z2 M>2f;>T4 0R,1JK 0 1[d01801<01X0P 30S .K.cKб0 0,1#00 1[0c?KH3d` (%0$ Q  @3 @R 0X0 P 20S .K.K✱,1"00 1[00KU ,000X0080<0F00S}Ԁ@z 01 w1StW p~  K ?K?KK R0^0 ʡ0N"01 4"2Q 3RXD2QH"2R  0K 2s 0 ?K 0K "+ 2 2@P#*22C2 2HX #*2 2C 1sSQ0@1 2SQ ?K?K 1 0 /H\ DL2s, 1 ꠥb"@۰AcAAIAYc6Mbb0AAAdbbAȸA Ab*AdA bhA>@ ùAAAN@BAĥb/@qAb"@ںA@;c@02 1 0}d0 R" H  R  l y 1[K, 2 ֜ ᱛP c 2S  R `0 0W"K⍁0 K2 P@1Kp 0 >K0p ` 0#00#0 d 00#00#0 h 00#00#0 l 00#00#0 1\K`p d0 >K1Lp 40 100 H0@0H0 KpᬛP K.WKIW/KDT$2K C/o"pP h20S K.WK02p"0W?K7W/KKᣛpP h00h0,0A\00\020S  0P # R (#(WKMw1P$U QU:PU:1!0@S3 130S- 2ooK. P`0#@000K0 0<Cm<n0`00PP000-/-1 01019@/-/-/ -L M    0H Kd 0-@L))-0 -L^ -Lk 0-@0L@0SP g00K0hꌥb 0-@LG0 -LG -LM`0P 0 h 0@0S  0 Kq%( 0 HP(5G( P (D@"`pbK1M  Fd -@C`p`C10 `pm10`pn10`pnx0`C 0#yT$ bإbcd p-L$M`1@P R8@ 0 0K08 4 08 K6@KpR 8K70[S/@80[S@ U I$9@ 0-LMQ^@0 QP K ! >K0P K?P0S)^   i^e^^`kN^\Y\{  -@MLpF 0000 d`P%`QUʀ 0! `0     !0 0SE`Pl`P $K0@vp0 , +{ b$cDcHcbbd -LM@P` 0R0%0 *(0K %P ( 0Q0%0 *mS @ `p`űp R  ! $K8`嫱(寱0 ,꧝Ac@ zd 0-@L@" " 0  -1LpS` PU @1S !S T"S TP11@T-1S \  0-0L@S00S S0S000C0S@ 0 0P0S000@@P0"  /d-$d -0LS0S0S R 0d -@LPTQ @P 0S 00S S 000CSH`P^Z04H$L@ p-L8@ -PL#CL0 A@P 0`ኣ@RT 0 ܥḇc 0-@Pp`DML!2 000p,`(P$@ @@ @V 0!82 004p0,`(P$@ @@ @V1 0 00!140'>0 08p0,`(P$@@ @V 0!140'> 0 08p0,`(P$@@ @V040<1 00!,1 0'>08p00,`(P$@@ @uV0400 00!0 0008p00,`(P$@ @\V 0!0 0008p04P0,`(P$@ @ @FVPޭ<0(KootAAܥbAAhbxA̱clm) A,y7Bd -LM0@SpP0S P 0@S=PB P 10S(KU7 0 S`* ( 0R*TZ40K 4 0 T 3[#[00p墠 PD3[#[00@囝00`  `@@,H*̱cL@ -L M 0p0P@X` X /@0S  ~@ K0S  W @0dS*@(KPo:@P(0S Sh0<h0K 5Kt 8KⰄKh0  0x0S|0S0S.0Sx0pS|0S0S`V!.0 ` 0 D7` !,2Q1,2(0ЀK8!>K00K0P1 91Sps6p!,21 ,20K0E?K0Kx00 80 cPPPQ`V IP  KCKUA?Ka a `0,K B01  K)tC_K6S0(0K 00LKKP  KKP  X5x@xP0S 0S0S0S90@ p6xP∠ 1 W0(01  QHL R P sh0 p ㆼ. H  B1`V" A      Y  (1( 1`(`&`X 1"$ #$0 :  (",$ "$ W Wnd0p0#$ #( #,`000 0媥 s |s03h(("4 h#0R] R 0      0SL00S 0"P0(8ഀ<00|00000# 0QAA!,0000嘩$`p 0$嚩008 0 0L $1S !0KRҿ$B(KR  RS00SX(0#S*p r 8 #8,1 #$$0"$(1 00 0  1 r(1 0 10( Q r1 c4,1 (     `! 8#< *`|p0P*$ 0$+`08 0 0$70إb@A b@Adc -L M`p@r0P0 0@ K -0`L@1@$Kkd -@`LP@@@@T 0-@LpPK0hdPhpP -@P8eL4u4S% |$St4 0CS0!1t0 |$,0h Frl0d 0l00d0h004t4,0004080<0@0D0H0L0P0 ^0SX:00X:0P&7,L7,x7,7,7,##0S 0,B,\ :\  04(B(0 $0(0< 唼0 ARg7,X8,8,H9,P9, Q0x4\ `0x$ h0R40|40h0v 0 4R0x4n t4S0t t4 R00h ,0 q0d0ldhx4t4",0l 004080<0@0D0H0L0P0c T0X0\ 0X0h q0,0004080<0@0D0H0L0P0t4L 0\0X0h 0CX0 q0 Q79,9,9,9,9,9,9,9,:,:,:,<:,8 0; 9 7 5 3 01$0/d0-(00l0)h0'hh RqppX lh HqlhP Q-:,:,:, ;,;,;,<;,$;,,;,4;,6,P 0t$,0R!tt0 Px$ 000P 04080<0@0D0H0L0vAhAAYAA -0LhMpp0 z P`KP@IB$Kp0S<0S,@400UP@) -0LlMp @ x0 Q`KoPPYTPD0S@ t0 Sx0 ST 0<84X =P(K0@- R 0Ad ^R300PA40 0-@LT  0DP010# T0S@00 -LlMp @PP `KPP<0SD Rl`VSp0SP KS // 0-$@L00C00d \0- LH@wP@@U000006cd 0-L@E0 Q 01 00 S0  -L0s4G, -0LQ 夺A p-L M@Pk`P0 K{`iKp -@LPU`P `T 0-,00@p`L00hP,P00S0 LB00S(PU000C00 0 3/P|bA -LdM`P@Ņp|噹xAP00呅 80$ 0( 80 0,30400 3\P 0 Pֹ0Sh0 0a0Kᔅa K@OP0a0K`0Ph0 @hX@ gl@ t l0t S(Klhg@Ps \ KTQP\ ` KDPPh T K0QQP 0%K`` LKX` n0D0 \0dKL @0 T04@ 00 `0Pp0 O \d@p7d0`V P0 `  `* RQ00!Tx T`@D|0 |0 `n00x0`018 < p\0` SQ  R:D8P V l00l0 |p`A 0S0t0X Kp0L0K_t a0[Sm h Dh@AJ}A<@,żA@AAD9B4B AAAXAF,0@ 0-@L 0d -L0M P@uPPd 1UP`0 S`* P]0 SZ`  P RS?o 2R0SL0 0 PB Vp   `PP"DKP0 0 0 00P  U P0  xPP VV ۝U Q 0 DK|P$KP6cI - QL0 $Q 廸(AAA -L,Mp/@/_PP=)_PPTa0 QL0 0D0 0@0 <0 80 40 r R08#8P጑4K4[S(S| xxQR 1 0SL KqP PA 0L KḤ[s 4[04K%Z0 P 00(K f`mZPP mVPP iZU dVP_VP|`xYVPl``UH0 T LK6/P ꜽA%@?,\?,yaraAAA?, B(>,A 0-@PL T @H0S <00P@T $@!bD,d -L@`PP` P$00S$0$@0S   " -L`]@Z p PPW,0S 0,0e@4$0S (0S;qP @ኴ$Q  ၴ(Q IAoA -L@`PP` P(00S(0(@ 0-P$@LT00000@00 3/@ -0L sPZPZ -@ L`PP ,kPd00 0S P P/@-@, Ġ ,,8^#ȠQ# R0A^0 4 <#0#\ 8 0 0S0/Jc0 0S0/Jc -LDMP@X P@ ` $7 ZA 0T0K0VPpKS0K# :V  Ol TK,0K0$C` TK`PK00 0X  @`p:/0(K0 `TKR`KO`KPK`Z  @`0S! 0 X3/0P0  X0 2/X0 0 3/0P Yp@Fy0V@@0 X3/0PYX@Z0V Y@0 3/0PIp0 X3/0P  SR 0 3/0 X3/0P Jc -LM0K0 K K 00 00 0K6 K -L M0K#40K0 K 0000K0000K K -LM K n   0  K -LM K l   0  0 K -LM 000  K -LM 0000 K l 0 K 0-LM 0 00 K 0-LM 0 00 K -LM00 K l 0 0     K -LM00 K l 0 0     K Q-L 嬵豾AP/ 0-@PL03/03/I  03/0 -`P@L03/0 T +@T -@PL03/ 03/03/`P` 03/ -@L0P`3/p0 3/ 03/pPp  03/ 0p٬`V0 3/ `03/03/Ǭ03/}P㻬03/0 3/0S Tp -@L0Pp3/က` `03/㖬03/LP `㇬03/pW⨀03/z 03//P03/ 0``f0 3/03/03/   Q-LpP`x0xS#  0@ $Kk Q*@J$J@ HDH P0 !~P0  -L@P`P  $00Kh/ -L4MP  p   @ 寱s0P  $ <0 < Q(K$`V,0Kac4 9/P$[80B8#8S  0U00S P<00<0 0`SP480K <8` 9/60K <4~|0 5/,0@ 3 \P (0\8p|0 7/:PU,0 0,0P0P 00e9)0,00 <0\|bGA`, -L M(0@`  ^Q 4P|&0K 5/2[  ,0  O K ,QpK  ^^{ 叮P ,]@[  [K8q|0 8/,0@ (08Pf|0 5/P0 S] PXP%XPE_oRU(08`P|2[ 6/,@NA 0-LM( @0K00 Q'0&4P0| 0K5/(04P(|0K 5/[P4 0R40 8 S$003/p 00S0S 4 -LM,0@9!;1K(0`K8P{0v 5/}_(04p{0 7/1[S<PU 0S , P(08`{1[ ;6/K,0/0,0<\$00/ -(@P0 dL,0PAoh RQ` 0.<03/00d0,0h0 -,0L@0(P  "%,p3|; S  108#88'00#P$KkկSb 0 #" b3  0 "pb3  0 &p"LXb3  T0 <"ݯpb3S 0 ("ͯa3 V   0 80,0 0,0+0!x巯a3S 080,0 0,00 d!(壯p0a3  080,0 @0,00<0 00{!勯`3  080,0 @0,00p<0 0c hst`3   0T| ,dW: ,0 05<03vAoAA`,@AAakA#AA&AAA+AϿA0ٿA̟A (Q-/ 0-Lz,0@`$Kk8T0X,@AA*A.A2A;ASAZApA}AAA.@ .@.@oA5A@.@ -PD@L@ `V(Khţ(08phw0T 7/.@ -L M@wPS 0(S3 (S lpW ,0 t0ht0ht0  t0ht0  t8R 0S(08`*w0 6/t0z5w0S S S00SS .Sg` pW (08w0V 8/(08`v 76/(04`v&0K 6/(08`v2[ ;6/(08`v 06/(04`v&0K 6/(08`v2[ ;6/(08`v 06/(04`v&0K 6/(08`v2[ <6/^0 0CSZ\&3V K(08v0V 8/` pWQ(08v0V 8/` pWHK (08`v ;6/(08`~v 0 6/t0@(08` sv |56/(08`kv0 6/(08`cv; 6/]v,5 (08Vv0V 8/` pWm0S p` $&8Q8 R(08 (08`~s 06/(04`vs &0K6/(08`ns0 6/[00?, R R 0 0000,0 R  R00000660000 0000 0000 -L M0B@`Sꀍ,H,,T, 0"S4_d 00R0H?oh, 2Q0S h3R0S S SE 0"S (04Ps .0K5/(08Pr2[ ;5/03 $003/0  R= 080#8S\ S SP (KS S P S@P0(0\||8r 0:/(08r 0:/(08r0 :/0  R= 080#8S$(08r 09/(08r< 9/ \1Ri0Sf0 (0{8Pr0 5/ZZ S 0S0SR0 #R   R  0(04Pkr .0K5/(04Pcr.0K 5/2[4 0R40+ 8 S(j%00S0S 040vO00S// -LP /@ -LMp 0P(@,p00(0`4#r .0K8/(04r .0K8/2[,00,0(04pr,0K 7/2[  000000,0 K 0 #0  0- 2[ 003 (04`q*0K 6/2[(04`' q (0K6/(04`q&0K 6/2["[ 00 6 60 6000@6  600q&0K 6/2[@000000006 -LM,0@9!;1K(0`K8Pq0v 5/_(04pq0 7/1[S}PU 0S , P(08`q1[ ;6/K -LP`q@pi  `(0 00(pp00$00,0080(004Tq0 8/3 L033 0囥,$Kk/@AA/@oAA@ p-L MP B@0R ܓ,,ؒ,,S  0"SUUS  0"S (04Pq 0K5/(08P q1[ ;5/Kp03 (04`p0K 6/1[V>01K(08`p1[ 6/(S  0"Sp -LRP 0@ -LM,0@9!;1K(0`K8Pp0v 5/}dP(04pp0 7/1[SPU 0S , P(08`p1[ ;6/K -LP`p@p 冤  +`(0 00(pp00$00,0080(004qp0 8/3 L033 0帤,$Kk0@AAD0@oAA@ -L Mp 0P(@,p00(0`4Dp *0K8/(04n *0K8/2[,00,0(04p1n(0K 7/2[  000000,0 K 0 #0  ' 2[ 000# (04`n&0K 6/"[000[Q000000660000 000000 0-LMP B@0Rꈠ,,,, 0"S 0"S (04Pm 0K5/(08Pm1[ ;5/K003  0"Smp -L*P 0@ -L Mp 0P(@,p00(0`4m *0K8/2[,00,0(04pm(0K 7/2[  000000,0 K 0 #0  0 2[ 000 (04`lm&0K 6/"[00 [ 0  0006600000 -LP`sm@pB  `(0 00(pp00$00,0080,(004-m0 8/3 L03ա3 0t,$Kku0@AA0@oAA@ 0-LMP B@0R,,t,4, 0"S00 0"S (04Pl 0K5/(08Pl1[ ;5/K003  0"Sp 0-@L(08Pl1< K0h/ -L`Pl@p尠X P(0 00(p00$008 ,0( Rp0,0(004l0 8/3 0 3@$Kk09 $Kk'A>A0@_AAoA@ 0-0P0 L@#R xU U U  Rl 00S p003 00xA 0-LP@pP 0? 0_lP 0`A -LP 1@ -LM0(@P,0 000(0`4pl 0K7/1[ ,00,0(04pl"0K 7/2[  000000,0K 0 #0  0 (04`k  0K6/(04`k 0K 6/2[ 000 ![ 000000 6600 -LPpk<@`F(  fp(0 0000S00(`$008,0$003/(004k 0 :/3 03O,0  0 '%l7 d0 P.3 @ٟ<,Ko%1@AA(1@41@oAA'AA@ 0-@LMe(04Pfk0K 5/1[01K(08P[k1[ 5/K0 p-L MP B@0Rꜫ,,\,, 0"Svv0 #R (04P4k 0K5/(08P,k1[ ;5/Kp #  R= 080#80C?o( 2S4` k0K 6/1[01K(08`k1[ 6/@j0K 6/1[0 0"Sp -LeP @1@ -LM0(@P,0 000(0`4pj 0K7/(04pj 0K7/1[,00,0(04pj 0K 7/2[  000000,0K 0 #0  0 ![000  000000 6600 -@LP(0U U U8Pj0 5/(08Pj#< Kh/8`wj0 6/ -LP`j@p`  `0C2?00(0 00(pp00$00,0080(004Gj0 8/3 L033 0厞,$Kkڞ@1@AA1@oAA@ 0-LMP B@0R꬯,4, ,̯, 0"SJJ 0"S (04Pj 0K5/(08Pj1[ ;5/K003 4 0"Sp -LaP 1@ -L Mp 0P(@,p00(0`4i *0K8/(04i *0K8/2[,00,0(04pi(0K 7/2[  000000,0 K 0 #0  0 2[ 000 (04`i&0K 6/"[00000000@6600 -LP`i@py  `(0 00(p00,00800C2?0S0$00$0p$003/(004Xi0 8/3 T033 8埝4$Kk1@AA1@1@AoAA@ 0-LMP B@0Rp,,в,, 0"SYY 0"S (04Pi 0K5/(08Pi1[ ;5/K003 C 0"Sp' p-@L M 0S ,0 (04Ph0K 5/hP1[ Kp4(08`h1[ ;6/)(04`h0K 6/금 -L?P 1@ -L Mp 0P(@,p00(0`4h *0K8/(04h *0K8/2[,00,0(04ph(0K 7/2[  000000,0 K 0 #0  0 2[ 00 (04`zh&0K 6/"[00 6  6000 6  600 -LP`h@pO  `(0 00(pp00$00,00809(004:h0 8/3 L033 0停,$Kk͜1@AA<2@oAA@ 0-LMP B@0R,h,@,, 0"S== 0"S (04Pg 0K5/(08Pg1[ ;5/K003 ' 0"Sp -LTPH2@ -L Mp 0P(@,p00(0`4g (0K8/(04g (0K8/2[,00,0(04pg&0K 7/2[  000000,0 K 00300000 -LP`g@p 兛  *`(0 00(pp00$00<,0080n(004og0 8/3 L033 0嶛,$KkH2@AA`2@oAA@ 0-LMP B@0R ,,l,,, 0"Srr 0"S (04P0g 0K5/(08P(g1[ ;5/K003 \ 0"Sp@/ -L MP`,g@p3뺐d1I?03/P G 0 4嘛0`(0 000 0 C2?000(pp000$008 0,0(004f0 8/3 0 3 P(024pf0 7/hm3 3  H D(KoU 0 ,PbUAAl2@oAA@A 0-LMP B@0Rܽ,d,<,, 0"S 0"S (04P|f 0K5/(08Ptf1[ ;5/K003  0"Sp 0-P4@L P@n0 00$d -@dL0S Tǃ`0HP `$`(`,00``000@@Kh\b,$d 0-$0L@S 8*4P 0$R00 K0hA$d,d -@L` 0S pP@UT P T 0R:$ $0Rp@Pp@@p0@0 00S 0  0 ` 0$00$0$d,d 0-@LHF0 000,S   0$00C$0K0hv,d 0-TPLL-@T  0R 00 0 bT003/4d\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc 0-8@P0LP 0  04d, - 0PL48<0 0@0 ` 0000@ 0@0 0 ,0 0,0@0,00000003/ 0P,` 00 Kh !A -@pLPt 0`R00 00C 0 0p0 0 00 00S TPv0p 0@@@ Khk 0  "4d  0-LM 8 00 00  DQ 0 KADd -`Lp0PS@ 匑@P D TNX U oPP 媑 0@P4 0pDd 0- 0L@ @x  0K0h蒑Dd 0-< ML4@ 0 00 $ 00KcPdA -l`@0LpS@ mPP @ S@P #0@0 @PPd 0- 0L@S V~ K0h APd -P`@LU@ 0RLP PE @ 0p P/P ///$0l1(0p10P1/ -L MT K0S 0S 0S 00K @0 4/KDd -(0L0S  3/Ddhb 0-X0P  L@R 00S 3/$0S0 K0h/Dd -L4@\P" P0Q 0000``06/#P`3p0 o00U000ም0P00 |, 0-LPc0@ c   0A -`@PLV000000垜Kh, -PL @`d!UEPA0D0000 0S KhA B AAA -L`Pp`c0@ᖗ R5PᆗP0s040000U R00000  F 0 00Kh['AIAnAA -L`Ppc0@MP R0P=P0s%6040000U0 40S | R x R@h 04/#P P Khn0 00KhAAA'ADd, -L M`Ppb0@P K rU00004PR剔QږP000U0000|0SL0 H0 0S800` 8/#P   Ki\EAgAA8,DdU -PL`P 0003/H d@p0 R @T1b$0KhR2@ -@L` F@$h@P(S0DS @1S P  0 0Kh/4c P00- 6@L$8S0S, S 0P04cAA -@Lp F@$p@`PR0DS@1S  0P 0Kh/4c x1- 6@@LP`\$pRPM 0S48S SA0X= @T6 0P`|10 1萔oP/@0H10L1KA@IAhb ,@ -LMP@^0`(0PS 0S00p^ 0 0000 ]0S x`@^d`*6p!:t@$|d 0p`^00b$KDd2@vc p-L M@`^P@y^0 0000  Kp Q-LP`-q@T+ 0Q) 0S& 0 ! y40T0400 0 0p\0 03/ $LdNA -L`[^P@`p0SPUJ P -`@HPL0SNP@1^9P 4c Q-L 奒aA -LM@ 0P`0 b00p 0 7/P0P PQ,,0`S  R 2/0`0$KDdvchb -LM@ 0P`0 200p 0 7/P0P PQ,,0`S  R 2/0`0$KDdvchb0 , /Ddvc p-L MP`]40 0@04/Kp -LTMPP`p@| 0 @ 04/p@qh2Vq /17V\ 70VX 7C0CVV 0@ 04/2Vy ?0CV00Sm Pl t`K0 @PT` A000 0T K03/@P60 R2  2/0 $ R) 2/ 0 ]? 0 ]? x ,0V 70V@ 0@@ @0000 @(K0S R 00 0 BPR  0 00@ @04/S@T 8@LW`WXW (0Q40S0000//TW@ -p02L(MQ`P@$ 2Qx 0Q 0CQ= P81Q< Y177Q o37QPP)  0 ` 06/$pW 0 <KPP*Q U R 0(03/Kp0 R ` K6/PU0PE( 0  2/ -PLpz[u@ UG01SE  nc40S 00Sy`u0` p`00Pj4P00 0000S  | R l R  $Kkt@0< 4/#P  ``Dd4, 0-L@"[4Q0T T0K0h0 R0 K0h/|/ -0L@SP` 0P`4 R   03/P  0R  4Q000//?o2\Q00//Q1S ///40S0/ q-Lp@P`?o4 2R0S0 @QPU 40`S@ 0@ 0 000@S@   @A 0-L@Z40S0T   0@K0h: 01- 6@L$P-K`cZ0S8 S 0AT 0S 0S Fp]`003/0S 03/0 Q   2/8000S 0  2/ 00 04cDd 0-; S 0 0//xd -LMP@ `$ 000' 0 0,00$(00400p0 $7/P 00 004`$00 00`(0, 6/P400K0$0 0(000,00 0S 4 3/<Q %Q 0Q0 .0 /AQ BQ >Q0 .00 .0!0 . 10 .0/5Q0 .0!// -LM3A@Q ,,d,,x,,d0SP`$K` p0 7/P0 U:D0C` 6/0` 0d0d`VPPpEPwPE0V:0` 0d00 00CR00 09/pGD0 P0 5/`@ 0  E08/`0SP 0Spp`Pp \Q-L| 6Q-L CQ-L& 6Q 4Q0 %Q/ =Q' AQ 7Q QQ HQ KQ EQYQ ZQ RQp0 .0!   0-0@00L0\P 0\0`P 0`0P 00P 00P 00P 00P 000T0K0hd0S 0S Ҡ /0Qh0:9Q ;Q0h0 0 S 0$Qh0  / S l00A!l /tQl0S0000 / 9Q-L0Q*$Q !0AS h00 S 0h0!&Q;Q :>0ASh0 S l00A!lh00h0TX 0 AQ  R 5` R  R  d    BQ / d / -LMp<0@@`P  d03 8/((000 00S<0@  d03 (Ko/PZVPEUP,\,,<-<-<-,,-,,,,,,,,,,, -8K0S0C 0<00<00d\ 0P2!B Q0 B S:0Q0  bAR00000W 10 S 000[ W?o20SJ <0!0!SM00<00<00 P0.01SXEXQ<0 d 1`Q A02 ":/0 Wd0#0@000:/0 d2!cR 00S 0.01.0 1<00y B13/9(Kb3@A `00-<040@@0D00TH0$0LL0 0P0 0X0\P  0 00  00 00 >0 R\ 0 HQ0-L@ >/Q-Q*#Q  Qb 0(AQ0=Qx !7QW 8Q<0  00000@00D00H00L00P01010 10100010DQY EQU >Q<00N_Q]Q*OQPY MQX NQ00PQm [QhP( l>Y0oQA cQe nQ00}Q5 ~Q1 |Q00<0<<00000@00D00H00L00P0001010 1010001|<00<0x001s\ 0n00000T  CR` 0C0R 0S 0d00 00CR0Pd0<JhP( l> 0m0,A0 00 -L MT@0 080\0`0d000000Kd -LMPP`p@ E 0 0000@080 \ 0`d0   ޿ ڿ ֿKd Q0-L@ :Q00 00 <@K0h/K0hK0hb 0-@0L 000tK0h -QL@<0 QQ Q <0Q Q *Q!R0 ,R0 !R0 ,R0!R0 ,R0!R 0 ,R 0 !R@P ,R @PU@ 0 `06/0@ Q Q Q /0!R0 ,R000// -XP@Q`1`!PEU0LT p07/`0S T ;0Tp D07/`P T0 P<`0S  0S 0d00 00CR00d0 -XP@Q`1`!PEU0LT p 07/`0S T ;0 PTD05/`0S T <`0S  0S 0d00 00CR00d0 -QLM@`' QQ Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P>  00s< D0R P5/`P  c<D0d 0P2 5/`0S  0S 0d00 00CR0K0 PD05/`P 0d0 -QL M Q Q Dd 032a@2"4/KD0d @02 D 0 @0 -L M0 @480gS hJS 0BSO @S  AS- $KDS_ RHS<l0d S0T X BS000`0S  0S00pd0 Qd023S0!0C00CPSL KS MSl T`XPR 00CS10N!0EL\X0T4T`XPcSQ fS XSld 0QD32`S0!2P"5/(S 1nS lS^ ChSl`P, PPl`J?u&Al?h?AAoA8B AA AA%A; S 430/ <8#8SA3=8#8SA@A210/>08#8S2AAP00/<0D   P2A0A`0pQ. @Q& Q% !@Q @2<Q# :Q! Q2 Qv =@Qr $@QD @Q0 Qk /111111Q3 Q111QG 0CQG 0Qh17d1Q`13 0QP1.LQ @Q @Q. Q11Q& Q00v0Q 0CQ 0Q0] 0Q 0Q00/0P000000Rd6@+jA-AnArAvAzA~AAAAAAAAAAAAAAAAAAAA-P0 Q  Q ,,," B( @0(S!<#" 0-80LPS0 @,K0h@Mc S-LpP S!  ,@ `V h V $0 3/D @hNT@@0$KkL,7@AHc\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc 0-@PPL0S00  R  K0h0 0-<0L@SP0@000 Bg<ְ,P  ?00p- 0-<0L@S0ǰ<,g00<0K0ht -L M@`0@VSP(03@:xp40 S4  ScI@!?Y pp<0  & 0 R  HXppW0S Rpp 0< p0< V#0(K 4  0P 00 G00A -@LPpA@` 0 RႯ@/ -@L`TP (0H0P00PD7@ 0-@Ly40S 040& 80S00K0h -LM0 @R <"p0CS3 :4PK  p(&\ K0< 0000000P Q@ R@// 0p P/P // 0- 0LP @@ @ @  0@S0l R0d h 2/ 0l@0 0-@LLT000 -LL00, -L MPK %`@h PpP 0 4 R0 W80  (PK8RWRW SW p- L\`P@=0@S  L00CS0𨝨d 3c H0- L4@P=LP  K0h03c @0- L,@ =LP K0h03c0 000/ -L`PL`0r@p00p0000K0S 0Xx0S1`0 $㎷`000`딐 + d y,`0  @0d0 0h000000l0`0SP }`0t0000(00,000000S 0$@4PP K+'X P l0` PP P<$Kk4bAd;-ALbA>A@A%-@A -LM`pPtKH4@V D84V ,4V $4V 4V d0t P0h5/`$K3V 3V d0 0h8/3V 3V P< S0< S< 0S`PH3V +0CV 0V $3V X 0  Ჶ p`P c 4` Ặ2V. 0CV 0Lx   |   0 0 000d0h`06/2V/ 2V 0 R00oa t@000000000 0 0 000t@0000 0 000`PTA000 @`P,A C4 @000000000@00000@000 `P@ 0`0 0,K0(P ,0 `P9L ` ` `W W @W@W @W WW@W @W@WW WWW WLb\b -LM@`pGJ1 P T  0CT 00 0@#0T >0TL0S# ,02@0L R 00080@ L R , 0qx@ @T@00CS0 K@}f~f -@P4L  :0 pKh3c-<0(Q$P Q0/d-4( \0^/d0Q000/\ `P/0 !`8 00 (  , !/ b$cDcHc -LMQPp  0q<0 0X `VY `$K0 6/P 0 S 0 0@ T`@ 0 Kl0K5TT 0CTI 0T`*G W X5T: 0T 0CTWW `0 0j: SPP 4T,$T=*0CT5 7=D Q `0 @DoQ: Q7 > Q4 Q1I @GW 00# @ ,W 0<#X W 0;# 0PP @Kl0T@@S d00h3/l@ 0 @@a0D8#8S @DH$H 0D!Q00T0S; S< S S S 0T0+ 0@0S0+ 0A T 0S c0C S@0@ 0; 0; S' 0 @0D8#8 T:S00@2T@ 30D8#8S@DH$H8T@ /T@ 0@H$H0A1`A`|1%#(*$' p-L M0( @R1 $0S 0S+ P`40 CS4 ,0 0, !; S Kp0$K K03/$Q Q 0 0 %04,0 d4b -LPGp0UPPS@+UPp W&0 `U`RP0 0'd00h3/`PPPPp U@ sG 83{W`gG `A-A 0!< 0`4 0 (   !/ b$cDcHc -LM`iGT0@S P'm'p0S 0$ OLPU% ,0S" 0p0CS00 4K40 00 ;P !< p0d P  GHa{<H@F0 6Kd|bA!AT7@ -@LT0`SKh0Sp Q` 0B0%31B %! !'P0SP 0S`0P0<P|bMb 0-P0L@SP  R 0 'd0h0K0h/0  0-@LL@ 0 - L`7PP@ @T@`V T0S LpW@0`4L`p@P Lp3c H0- L4u7L@T  L 03c RL RL // Q-L zAA -<@`P LF  `PR0(0d0-\0-8- 0-P@LPPPJ(P0d -LMp`PBF0@S 00h&80S$  `PPPP `0sU `0PmQ QP 0B B0%! %313&KLP 00 04` S0P U0P000  4KP E x|bMbMA 0-@@PL0S@06P P0S @3c 0-( L0$@T P0d 0-L@@6P T0SL0SK0h003c 0-L@PEP@0 -LE000 0-L@PEP@0 <8#8S@ /: S/>+:R0P0S/ 00S/7@ 0-L@Q 8B-PB-pB-B-B-<000000 0 00000000000000G-!0S@ p0P`ᴀQ+:S0C\ E F\@0TP`ᴀ000P@,(`Vp`W  03#\0C?0 蘩b <-00000LDQDa \0@T ^? 0@DoX: X7@T4 AoP P U >  P = P Q  P P@PhUlNoV  ^Qڰ <v$Kk- pW mA -0L`S@P SV 0`1 < R؜ 0  0  0  0 0 -L,M0`T@K ^@CqTPK|䁟t%(KPU Sj PUc 0  0^LAoY YPT0KQ p 00W@D"*  Q= Q R !Q   d\ p* BoZ  RQڰ  "n Su AA 0-Pd@LLT0003/X@ -L 0-Pd@LT0003/LPX@ 0-@LL@0 -L MpCPd@TU(K0`V 0 6/PPX@ -T0T@L0 F@ QCL`V@@TL@خb@ (  !LP  /خbH 0  !LP  //خb<0 6(001LP /خb/ -L Mppخ@P ^ӮPP`@ K0d`h00 0pu08@0p 0l`0Aܮb -0PL `R p Ю@P@pD7t0AT$@P*t0AخbAA A -LMPP@ 0TPX0h0\0h0X0h0P0SLQ 003/P 0X T0\0R\0h0\0X K00S 3/`l0S 0`l p07/W 0-TPL@P0S 00S 3/X \0R\0h0\0X 0T00L0S 003/ -L$M`@B3PV ,>C0CVL G0CV 0V L0SP0S o dpWXh 03V0l0b3V 0VPl 000802Vp >:C?CV 2V0SI S_ SUn?2V o3C7CVdPp`Ud`^LP. \R\\b`qXWʀ 0! `! 0   , !0 D0 0DK@0  0!!`q0   , !(KP T0SL0S0 QT0SdPU 0 0RA0P!XP Vp 0`00AXPP P , 0q xPL0S ,020S 0 0 :/PXp.~fW|fbWaWdW b$cDcHc$ 0خb -@LP F@``P@ @ @@PU T0S L0S@0P4t -QPL@P P$A tpPd`VWPXA@ A <t00S 3/PPpX`A)A 0-@L!ATP0 PQ SK0hS 00 Q-L uDA 0-L@P\1P0@P 1P T0SL0SK0h0QA -`T0L@Pp 13/ULpP`T0 0T01Kh/0T0 -Pp@LM`V$K 09/@ -LM`@pW$K 09/Pp0S@PRQ-\ Q <:#:^:\:08@ -PpL0@C0`p0@@A `@!`pW8 (0`@ -鄀LlL L`pPA@!0B"@p`V8 (0p@ -LM@TP0L    lA0A`Pp # PR VpW*(K pA0A0000Q00 0Pe0 `Fh !$ Fa8 X  Y !P4 0 pW:X4  ! QY 8!  R 0 ) 0 PA 8@ S-LP@p t"~ `Y@`X8 '0S )00@` R-L` \@p 0JhY P@Z8h [)0S h T)P@ 0-LP@P 0S 0@S 0000R-`0 B"1\1L -@PlLPT U pP#80&0Z8 0S  (0P0ppU`h pP -@PL`0P"0U#80&0P`V8 0S  (0P0 R($0 0// -Pp`L0S IX@+p 0000@ Q000 Kh/Xb -L M`l @RpP":pQ:AQ  A8/ 0x%\ 0 BP #p Q BB<"0 9P* K0 -LMl @RpP:p Q: BR  B 8/ 0l 0 BBl"%\0PQ 9Q*$K0 -QLMpP`@@C@0HS`0 p0S@0IV$K`0 `p0VH@D -LMR`p@@DT00 0 00 0 PU$KP -QLMpP`@@C@0HS`0 p0S@0IV$K`0 v`p0VH@D -LMR`p@@DT00 0 Z00 0 RPU$KP 0!< 0`4 0 (   !/ b$cDcHc -LM0 H)@`QUʀ0!`)0) )   !00ZSP0@00 P 400$0V0@04 00$00 , 0 4 00CSppvq(KT0 V40, @R0 4  40 <0 080 0b|` 8`p `4pX 8``ApR <`p`FQ0S`T0V`40 000000 S Z `0 dS` Qd`ix.40  de l p.pqhpp!PpLpx  ! 000| 040 \P 0TT 000 pZhpqgp .Gd 00C0' 0R0p0pC  0 0RS0C27X5A0L50D50@50<50850451000Z%0 J0 Z `j-j-j-j-j-j-j-j-j-j-j-j-j-`p\p/ ` `.5;S? S S `L>`l̠ \" `Apppp0pppppSGQpHYpppppp)0C2.c<>x'x(W<8L"(#8`@4  㾀Q \4 4  X:꾀ᾀᶀᶀa 0N6aPn0 A0 >3p aQa X:    R  Lt5( $s@`p  -l R0T0: @($ ,0S X`YpZ0F<0 0f80 0GD0 0g@0 0HL0 D0h@H0 0PP0 V ^80<0[R33W ^@D1\R))XH ^L]0R))\3 \\4 0P0S\ \T c(#"$c4"T $ 8#<8#88T (4(#<0<8@AAAAUUUU 9@ ̠ S / 0-LQT0   R: ,0 30,#1 #2 R0 R,# #9@ -L MPP `0p@!L,`1 V ` Q @0" 1!pW*(K00#0Q00`0@x b 0C  2 1pW:x  !Ry ! R 00 k# 00` @<@L@L@ -SL4M`* 儠P@ A 040 0 P8 00 c1!0  40Z P0z c028Aq8 (K ^! D H!@ 4@A$$DL \@ @$$D1!DH!@@  0@1!! @$@Q@ Ph 01\ D0 0@0 1H0 0c0<0 D0S<0 HD0 R"@T< 40q0ZpL0 @0  p p@PA@TH0pGB @BS 1T0 1X0 0 P 800Cs80 p H0SD "<<"$0, 4#,,#4 <0@  R d R   ̠Ġ  1!,,!  0##4<!<<!00@\ 0#00#0X0 dE^fP0D0ST L0AS@,< $ <(,Ġ <  40#"̠4̌8"$,00L  R4  b ^   ̠$̌(   2. $ (.  00 <Ġ #,,#4 <00 N^<  48  0?00<0#ş0 "  0S T !00pPD<T!,4,8!0,04#$(#4 <  !48!0 038##4   mD 0004 1 00 0c S0à 4,  80,Ġ  00 10 H0AZ@ @ S 1T0 1L0 < 00@P0 0CP0 800Cs80 X D0S4 S 0#,,#4 < 40<#"<<"$,004  R4 a ^  ̠̌  1.| t.p0#  #4<00Pp03W#̠Ġ #4< m0<00#€ 0!R B L0p 0bX0 ^vL0H0SE L0,<  <,Ġ<  ̠4̌8  00@ P b R   ̠̌  1"" "$, 0# #4<0# #4<0@l 0#0 " 0S T  00@PA 0pq 00P0100 a Q ́  P |R 48 002#  #4< 48 0X 030##4 \<@L@L@ -LMp`P@A #` !&V` QP0 "41X*(K 0"00#0 R00`0PZ1 @b@L00 00BB00Z00140 ?1X:Z  "  "  R0 R 0 "  "  R 4 80   80` P B<@L@L@ -@L4MP@PpWpCW{*P a`b. @  `P"( &  V`", &  S Z | $8 0,@ 08  Ql%S> 4 2 00 X9:808 80 $"448 8 #848  4   8 @ Q1"<"Ġ <$00 0S0`0P 0"00#0 R00`0PX*0 0'0c PR'`R (K,pK0>,0 B0c 0!00#0Qa0@ $ !L  D #!P  H D Hr  b@P "< D    <S0 !T qs2 00 <0 4 1\0 0p0cRXh:808 80 $"448 8 #848  4   8 D r @,K00!QD" "$,  <X Pi\ H r0S T 0`0PD0s0L0 #  "0 < RGH rP !  " 0S T 0`0PX*0I 0'w0c <0PR`W< 0PED0s0L0 #  "0 < RFH rP !  " 0S 0T `FpG B ,pK0>, \"Ġ "$ X @X {Ϡ,K 0<  PH"<< 0"$0, k  B<@L@L@0000000100/|}-r-tp-@- -LM@P`@PpW3C\/*P`!'P*( V& `Pq*, & S!80pK/ K#8( |0$p|"p8#8Y%* 0'0c wPR`)W=(KpR R  80  80` PY: !$$("($$pQ  R  80  80` P,Kό\ 0/[PE0 S 0S 0 `FpG -@L,MPP@PpWEC ZA*`!. V"& !P`0  Sx", & P4 'x7 |0$ '2 *<  8 @  0D  L0 H Y_*0 0'0c wPR`)WQ(K0R0S  S0`0PY: 0\40$ \00! 8l<0#CX0D0cQ[0P0 @0>.Y0N0c^3\>P>HL!AZaP]10 X0pS  0`0P 0PE0 S 0S 0 `FpG49@T0 (0X0050 0R 0 00/-@- -@LMPP@PpWJC\F*`!. `P"( !y V㊘", & !` S0PsK"K)80 X:80 0pS0S  0`0P$p|0|"pX*0 0'w0c PR`W((K0 $"44 8#84 4   p8  R 0S  o0`0P,KQ00[PE0 S 0S 0 `FSpG -@L4MP@PpWpC W*`P!, ` P"!)V `8   S", p< Ƞ,Ƞ4 * |0$ ,,20  D  @ H  0L  T0 P YV:000X0 0>8S0S 4 0`0PY?: 0^<0$ ^80! @ nD0##C$X0Lp0cR#[0\0 H07'Y0G\p0cZ3\:7P T "BZ  bP] 20AX0\00000 0S 4 0`0P0 0'w0c PR`W(K0PE0 R 0S 04 `FpG<9@X0S 0 Z0X0R  Y  5[ 0 0R000/@-܋-,00S/  R 0d -`PLV0@P0# (( N`   p $B0$pP`  0`000   @@d"/ 0-P(0L@T05/@d-X0P H \  , "  db -pL@^@P P@@@ @S PUR  ^V WQ :P@^@<0 N R C C@ B R@D @D@ N!N' -`L MpPd0@T U000(K 0 0 0VP`@d -P`$0L@T 5/@d p-0MPL`0PP@P  , 0< 0 00 20Kpd -LM@(P` p  Xp0``ap0F<0 0 S$p`0000P P(K0$  #80 0S"140 0 ",B,08噡*S: <00垓#4 0C0 0S00 =A -L M@(㥛P`ᖛp " @p0``apက0 S$p`0000.P ᐛ᎛P(K0$  #40 0S100 0X3 K @`<P 01L!0kPq 0 S/ 0 B 0-0 ML $ 00  O KcAd/Sd 0|0 8?o20/ 0-@LLa| R|0d -LM00 0@0R9!(0 8[?08000P JK0S  10cK ? R 00 R (,( @(@ ( ( ( ( ( ( ( @( ( S K  K![   K  K![  -@0Lv YpP 0 `   1`S 0 C10c<D1$@dP0p0@AD  @<0  B," 00dS(0 ? 00o| 0-LMP@l@K KKK K 0KK0KK0 0-RLMp(0 x@XPh`!(0 (P ~$K0S 0(K0c ?( R 00S=P   PPX -@LMP K0  `p @0 `<6K0( x00/0 <#<0@00( x0 0/ / -LM K K -LP@` ` ` -LM@p` P0@ ,   0 @_VBKl @ P"K 0@PI000$K&\D  0K 0) -@LP0`` 0 000 0-@PL0 00000000CS 0  -`P@0L%S @h z@ 0X  q@ 0x0 h000 h0S@h @ 0X  @ 0x  h0h0 -0LPS0 S( S& L[b@`S S@0`( 008#80"$R*0( 000`C@$@`\`@`F@` $0T`0$`00Amdmd@ 0-@PL[ K0h{A -L$M`000 0!p 20K@ 3[S 0\0P00   S$: R  N Z0P R`0 R Q\Q\ <0 2/<0P R0S1 \. #K܃K( ?X0%! ̟?P 0 80< L2)L<0K b8>"P 000000 R0P e0S(K 3/p 0-LM@0 P0!$ 00PP0000(0$0S S K0.00(0P(0"0 BE (0 @ -LMP $p0@0( 堡0 `40 40Y :(0$p`000@0S0005T"R/ ` p@T @ T8 6:T @ Z뼂 )T T" T@pG `"`V 0( 00$00C$0(K pG`@8 _8D D@@ ~ p @Amdmd -0L`SP U U@ PP  < 0P0 <0AAA 0-L8MD ( DK @0 KT@ -LDM,0 x0H0 0@( 0K !$ N0K 0 O4[S0 LK H0 0H0 LKtKU@U@ -L8M   +!K (0 0 DK @0 ^ KU@ 0p-L$@0a@ @0 0X(K@P bAdbA -L M0&0K0@%0K2[P,C R pC`0P" (,@~P{b T` 0RX00 K0 0` -LsM`0p1  (1 p 000"pP@0@q/K YCP!4"6 0)01, K201 @P>K000;!0  !?pP1 0p1 0P 1R R 0S01 U h㎐@h hr/K0hpp (0!0(01@0 0000(0:(0,0<,0;40 0001`010pPPP 1  0P 0C#>K000?jpPs10\p0P00ãp001 p /000LI Xp 00p0 0SEXH 0p0AX   P P_o l RPP) U+ pP$pP-@0s/K BPq DUQ P`XЁ \P o01 @dT6Z0X0PX _ bp(Kp@P QU LX GT 00edAV@AAAAc -LM`RP} sRz(  X@ @@ p t $K@  Pb 1( Kq1 @P(t0S t2@p0j%P(k2@4(700(0& 00Z@P(0((  )A@P(C0 (w@(e7T (-A(C(<2(C0 000 S@0 S p p0!QP@ C(2@ b@ 0-LxM0Q0X#P@ K|| @Pt 2K00K @ (@P    8  b@d -L8Mp@`|P8!!""8:#:0900 000X0Hh0Xx0)(L0(00,0LX#t0S  \0KD0 0 @0 00 DK\ #KX 4 q0TKL P0 0H0 9P40, ;c(00|x0(0000L00t00$K -L @ -L @ -LMt0|0CSR#iSR8KAPP Pt K80s $ 0s P80sdP(0 KiNAA -LRA -L Mp@|` t R02& WPtP2 I20P 0!U0 W K00C S!----------- 0| ( X R%   / 0+ 0, 0 0 / -p0@`   x0L00H& R*0X6\6S `&R \&``60C`6H&*PeN` -B^ L@R -4=S B` `0S!>00CSʺ0 V0  =# C!  R]P 0S = C!P0S c> Pc> -LLMP0<0 00P tL0 Qp2|(`$0P0 囋?P<0P,TR PH60@S\680 H0  <00#280 ᅋ80H \`60PX6<0 P@&D6 0KLpP ᎋ(KL0X0 P00KX}ЀX0 X0Sp.B.0WP'0P 0 0P 00K000 L\PP0 00pW ԆK   ? TP TP WP R Wt HC0P <e> 0X& 0T0 0Q 0B0 0S0  . X0B^ pS0`2 K 20[S0 *<84;@0 4D0 $K ?  0C  ?o  20  20K ! -4S S 20[0X0SPP .0-400,0B0`680A00H  h@@-H0H \0?0A@P" 1b_@0@-@Q0ST L0R PPU00A@DS Q U 3=?000SࠓࠃQ^U ?6?0000- A^ ^\CS0Q Ӂ0ѳ 0ҁQ/0 -LM@`1@TP5p4 K]#KS#KR)< ,[+0[{.B B2$U 1yV l!<RX!gUc$K0V00U0;ų p-LMPP`@ 0 Kp02K1K(0 20Ġ$0K50 !0K{Ό2 ?0#K,K, 0KKy\ P? d%0 ꀖp@-0S00R0100 ^# P @`DS!?0 Q  P. 0Cl@ T @R@A@^00p0S*0RZ@ -L M Pp0A S0 00.SR0 .QR 0@0S Z@00W@@(K \.\ B0@ T .T.Q ^ZS= QCB@ ԑA R\ \@C 㬑L\00R0S`)\@R_000S00T? WQ0 `X T@^ B@ 0\ L S.S @0X S0200`V T@S B@  I)0f VqW|.`KT4KW 0Br Q c HR~ 0F0 PVm*00Z@ -LM@p`0 Q s.R R 0G 0S/KN/KKY0` 00pp 0?KP `a      X@PPĥ(K -L"MPp@@ `ZSX `$K/KK$ X0@ H X K    T?KP p@P T@o P YpW 0SR@BOoB$SR 0!1RQ@ 0?PPET /KZ@ -LLMp?00CS@`(K@0 `0RpPK . fK* ZK&00 R/R SYT@K 0 G 0 '?Q QPR0S @PB 0  ("(R !  Bf Q PR!?PR !?.0S AP R/030 -L`0Sq.\ \ R  0  /000S/| 00/0M000Ѝ/ 0P @/0P0 p-@|P|`|0ML 00 @`@x>P0 00 @`@>( Kphאdc"A,A]@/ 0- @L CCK0hɐd -LM Q|L  K+ K -@L$M`0K 100PS raL S^,x$@@x  !008P 0,0$0$00040XE 0L00s0X0"P0L0X0 !0\M $55%5L00t0 0t0X0S  40KPgd 402\0)XL0|@0L00x0t10 @pd0`O< 0\00@ <0K0$ 80K Y pP ~A K0>00C00 \ 0/ KiWA -L4M0@8P 40 `L0H  0s $ <YKp(Kp 0L/\0S* ~pp0FD0 d0V80H@0 \X0X`40 080 h # Zp[ 80Kld0 @T0CP A)A 0b03"$pP00p 0 B \H00 9 Z0 000@  0\` .pV8 r 0040KPd0D 23h080l04Q 00#0 p 80KHSpP ~k L H0C200 0IpA -@L|P9P (00`EN܎|`@d p-@LM( `$ Ȏ(KPPC>P⻎(0 0$00 001 0!00Kpdd -LM X  圎 KH\@P4׎K 5ώ?ddd -0L`|@@ RP 4 R`0(PP\0S  0P0$ @0 8l@0 0C?o20P -LM L@  N K8P$剎FK0 0傎dd 0-LM`0 x,0 (0 10Kh@\PpET 0S <f K \?@dd -`|@xLpF D2 @ Q ! H0P0,U x x 0 d-   1 `00C`0`0  0`0 1 / -LM KQ K0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0 -L,M`?oPV20R0<4 S8@p (KX R@ &L00 d0\PV l 0CP 230Wl0CL 30V00Q \0d Cp0X0VQp0D K00D0 @0KD 0HS<0 0000h00 00D @0R:0#0j 4P W@0 ld C@T  D V0& PQS\ R*4P  W 80K000K< K<0 S 4P 04Kl 00 B<$"[Pi<800 @4S:P \00sp0@ Q@ ""@ @00@0 D00D0 4V P D0l0Ch0cd0 `\!'0S/ -L M` @RP/ `0S 003\0.0Kpl0 0C#0$Pp0p`0$K00! z0$K 0!{ 0 30809=p0\o0C00D0l $`0 B00"$$ 0 0000 0P   +Hp.0Sp(( P H$K]@AA -L(MR@pPv\0Ss:0e40K08 K00K 0,K0l 08 B$"q`P= ,00400s7/0@!S  R 00# ,0R( r. AR040!,0 040 "  "Ġ #K8 ,0,0 0t0,P $K0 40%SKP040,0" 04$K ! 9` -LMP`@0 0 0KjpP KT 00@-0@ l ol0LS1! cQ\51: P0#03Q0#S\ 0l o AQ1 -@PL4M`H0 QU(Kpi\ 0H0Sp`đW 0t00SP0S0|<0K0@ K80K#4 K   8 l0$ @  0C#0PH0pW1`P4< % p+ P0H4  0  0 20<#4K0<0R00<0 < 80R*W@ 480*ĠᲤK<00 0*,K04 0#<00! a<00 -L,MQ@Pp 8R 0p00D<K040C\0 9D0 k0@0 `0H D  R*0H Z5:V( 0Yp0 0@  " B r  /oJ L0 UL0 0 0 0p(KV`1@ 5  " B r  /oJ D0 UD0V`1@ 5 mNA 0-@P`qԁL,M80 U\0S *8Q 4  K0w00K0,0K4 K40S 8Q  i8 K   , l0$ 4  0C#0yP4`20S s& S80000<0 P8 0:00 3K0#400P80000&P80K0 0080000 P80$K 020!00\ 0-@L M00 \ S:0`0q`0\00PS *U@ }; 00xaUQ 0000s(0S `U TP(0K, K Pz0 K ( l0P ,  0C$#0P $K -L$M@8PX`PpL00!h0!s00P0hSh  h0p0l0t0V0 l00l0 40K P0 (KX0 Sl0040 00K0440K^0P00X`F400X RX0 0l 00P 480 n80h  00C h 4 00Cl00 L0 00 CS0 4 dT040 l0$ BL,p 0C#0$ 0W\pdM!Ѝ/ -LtM0 Pd0 0H0 |@l d 80 0pP )0t ` (   CRp(Kd     {P d00SpL0  / 0.S,R R(0.S%`0BP` VrL `l Rt R3 tX0   l0pPX X0`BooSb`V !d008KBP P5 P0p0 ` p  $0`p0 0t@l0`0 C/oQ" R000X0 0 x@ |@ `0 \0@ SEL0K0D KP0Kx P P: px  0`lD A)A@ 0bHK@L"<3$~Ph 0h H@L0Sx00x0 00h  \ h X0QQ S0X0 |@ Qy0SO 40SL  %0pP3X0pS0X0 X0|@S0FB0F,@00%S0X0 \0 0S0 00\ `0 ` h0 0h0 F\`  P p0S=  \8KP7\0 0KP0l0 `,@SR00\0F00\0RK\ 00 QK[`q \RK\QK[`LQV R V@BP` HX0 HX00`0 P hR@l t B/oQ" R ` X0 ( t  /pPX X0`BooSb`Vpd0 P X S`Boob`V  d00d00  d0 P rP S`` P` B -LTM8@0X \ (0pP0 ,0PS:p0d0A1000 H P 0 \| (Kd \0H2\0,d@0K00H0K4 KTPlH04 A)A0Sh0DK,@  0b"<3$DPh`D @0 0` `]H00I0 0J0 0L0 0M0 0L0,K  0\0 0!8800sP0@0T0 00S0P0 \ 0\ `0 0,d0 000h0 0P0 P0h S#:T0DS X0S} L0 X0rH0 L S0H0 H0S<0K HP0<0X |00ah0pT0DS5 d@0K `H04 K06P,l4 A)A0 0bDK@"<3$Ph0`D000`80 0d` 00\0 H0P0P P00P d,`@0K4pK00 6|Pl4 A)A0 0bDK@"<3$qPhD0 000 0X0 P0X S T0DS? p `FPfh01T0DS) `d@0K F0 08;Pl4 A)A0 0bDK@"<3$0Ph0D000P0 `F0P0 tP Hn -L$M`8<0K04 K0 @P @DOoB(Kl4@ A)A0 0b8K<"<3$P8$PW h000PPP K -LM 0$ 8 K -L$P (, 00 RUPQOKQ QE@@ 0/-/0M000Ѝ/ -LM K K 0-@`p Lpp X@`@`b $@#0 4@cddi -LMPt0S 0S?@p4K0 0 K4Jo`P⩒4$p!0  $,P@$-(K_!P <0   u,P@=$A$. -LM@0`S@P`0p@|P *K $ 0KBK( $ PP ,K`K -PLP 0 @?P #SR 0R 8Z$SR 00V T0 HML0 0L00000s `0( 0 ti> 0 ?P L000L0000|0s# `0( 0 tK> 0 ?Px| L0 0 0L0000$(Ko{\a` -LM0@|p0S   R`0 0.0` S 80P\pH @X1!8 U 804 K00P 0PEP80l @<)@0 l2>, (K8 d0l 0C 3ß#KYXP -L4MP0S (KP00@|`\ P0t0S8p. pp R  \ \0P$K0KD0S H0D C20 000|P 000 0 = S_ZD $KDd0hp@1à@ c SΌQŒQ@ 4 R300 D0\  0 @DT@!0KKP0$KR 0R<0K@04 K0 uPl4< A)A0 0b8K"03$D jPx8 p00 0CS@1 kD8Z0ST -L,MPt0S S q9 0|p@ 80 8` \000 0P00S(KX0\X0`0(0@0D0 \0<0 < ʟP 0`,pd 0R ``8`<0 PYQC 1N`0 &PV 0 \ \ >0>00S HA00`, #K0@0 H0@ C2000800PD0SI 0S\ 0X80  g|ԃK@ 00t!0 0\!K 0 (0000ZVj80X -3 0< J`Rp`\>Pd V40 #00 (CL8QP |  0` #K 0'P R1(Ko +)SAM!Ѝ/ -0 L|pt0@S|`P @P W -PL|`|@ V@P  p@P 00 -0@ B@ -LlM0` `p ` d0 ` Rp S `R @p%d0S dP  %`@S `0@P`|PL00 0S 00.S |0S 0 p00 0 &@000l0 n|0h0 d0`S|00 h0,0t0 h000|0 p0 c#@`&|| l0XX Q00Sx0 0 TS dX0d0 kh@P `]0p dK@P |0h0 d0S! |0S L ; 0 <P l0S0 hO@Pd0 dNdd@ \ Kp|@PU040 00%`0 `K@P %(Kl R @`0Sl0S @7%`|0U l0Sx0S X0Sj|@,00  PK \K h0t h, |0h 000 p0Q@P PK `Q%s400400 ,0@P0 `l0S 0$ tD0 @ ( 80 $08K< 40 (0 00 d 0@0h@P @t0`40 80Sh0t @040 D K0 80D K` 040$000(0 00@0P8KlTd  Bp0C2 A)A b"30$@P80h 00:!40sh08@P `6`$@dP ?/000B@@rAA -LM@0|P0t00CSu6c)WV`808 dl0A 0Q a6WQ00+`P؃YX$ 000#SR $Kk$8l A0)A `18< #$KA -L M0P|@"X~5@8 808!$!60?r5p5KAA@0|0\ <I -LM`|t0 S #& ` ( !L 8 x@@S p @:PtP2 I02pP!90 :$Km00C SH.H.H.H.H.H.H.H.H.H.H. 0` / 0+ 0 0 / -LM0|0d0 L0` p00 0S0  $K0 0d08P0!0No0@S0 T0  0#20 Bo0T 22`0 d0X0S rL S$K@R0L0Ж壂0P0 X@00s 00L RKldh0l A A1< a20X0 1\0 T0`K,<, 0 0X 00000 ,, ∽000Sf: $K`Pf 0$KT0S KT 0P  P P RTT0 dp Q a2SQ\ L00 0Ch 0IY0 010!0 d0\ \00L CY@0K04 K<0Kd`P9l4` A)A0 0b8K@"<3$`PK8 @00C S 00S00 000c00 8000 0Y :$K K` R0VQ*&K 0 \0 0C0d0\$K R? Q0R0 0 0S VP   0yn0 0 0rn(KQ 0S0  00 D0K 1p4[0$K 0 $Ke 0B0K0A0K$[Kq0L (KBKAK[. 0dl(K@T0 )K(K0/0L NRK0  n><20p0 >t0 K)K` <, 0 0 0 eP1   704K00S'*8dl d0KP0C C c3̎|0 T00"x KH0K/0 "2- 0 00  P 8-`6$K 0&KT0S KT 0P  P P R8`T0 Y0P0 \0 $K&K\ ?*K0P0 a$K&K@0\0 $K&K@0\0 `*(K0 0~@@ -LMP@p0@`0 R@,K,@K0V 0T0#L0 0L0800"0 VT,K,@K`0R 0 0 W@T,K,@KM00P N0000K -LM0`|@X0S, \0RP#+* px KT KPP 00 CQP\H (K %K#$00$0!$K808 $KQPā#%K0L#0 0pLpqp' XppW:#:S%KP0pp 0KP 2W" H0C2000 0 fP$ 0 W !KSR 0!8q#<@P  00  Y B P /0H0 K! 0 4|a ?0) qԅK40|0 lK|!  ?R$K0,&lK000A@P\ R $000C\@ %lK40040 @%<00<0@%&KH 5lK1"N@VP0800`5lK1"K@T&K%8L+>0C6Sy`K0 LKP @ 0 `000 00x0 00 弞 0@`(K0S[x0`$S``V Ao@0Sx}o@&K(K0@$X0 $`(0lK0(0y0K0x K0C@P xp?)KW800 o)K (K4#"(KK3`#R 0V03`1`0(Kj@P(K`"(K`+#8o幞y0[Sp `b"m00 0U&KK0 QPn1300x0 13 @o(K*0`(Kz0@x0 !3B=3绬@z&K(K$0T0 z 800 n$ ? (KZ"P@$ ? (Kg"P' ?)K11000(K+j@PV! ""8nPT%\@ n0 RnL0KY 0 "(KK#R K`)K (KE"0#B-#1T`!@@@8080T0y0KY@WNn0 Sn !303?n)K (K-"zn6n0 R90#B-#@@@808.X5d b8A6d1u -LTMP0 0p`0 0S\ b t0S R0P(K|000 `0040 x81D0 400  401D0P 4%t\ @P40AUT\0 $K0`@X0 @0 L0t Q  P (Ko>0D PPP Q QN Qt'000\0PU&  00! QPP0<0 080 #KSRKH0<  C20<00 0PP 00!QP*V0@0 PtQ Q` QX :Um0SV@&00000D0 0;00@PPXl 060LPP K0`P@0 kfV`!PD c@P 060 %*PP 0!U%(0P 0D0u$0L0 0T0 T L0S 008S ؀00!YX0\T L00$0C P 0< <  R  X #RLX *^YK00 CSRD 0D0P +#800800040070 `P 400 ` `008So00!QPi0@#000P< P< YX 0H@0 L <0T0B@ <0 0I S103X0 5@000L0 `00T0 L0X*0L 0Rn*0n@0 $00CY00 C$K)!<00 $K400 0 0  0K0K% 400 %KSR0 0  0K`@0P0``t1`E0S400S008S ZDPIP 0 1 %0600~P '0PT0S 00 C<a4000 0P < 0P < i%$K@'P\$K X0S`g'dP bX5dpbWA -LDM$@`@@T  |0T0 0P`000<X0 00U RL KP d0 0PP0 d0 + X pR Z !P, PX?T08#10#W00S TkXTkP L0KR  (K1 Cr#ӑ #ÑlP zk7k0!P!0BqґB‘X0S &KT0T8[k&KȟH&KT0T T808Hk0STkX0S T08}kt=dH@o/ -@LM`pK K K0 0`K@P &KP0@ K4/@P9[W@009K K0\4/@P H&áW 000 0(0xA ciAiA|bA. -p 0LPMP0hK`Ѡ@P &$K. RK dKF!>W3K0p V5K!>4K`0@` P @d K0Lh4/@P 8&hw(0( 0 0ัA ci@A|bA. 0-@@LPHfPi&010 KKP0 @ @ ` i<0 K0@04/@P %Ai cA  0-LM!K000K00  O K   -LM 0K # 0  0 < K !>-LM1K00 !4KKӞ K -@p`PLLMd ` P@ @TaV`|%`0S ᗉP0T 7  `03/P PP [ (K PP 0 d8/P {%T PP CPP TP >TP 8<0 X0K04XP PT0KL KPK:/#PX PTK03/P0TS 0SP0 00P0  000 C#h0K00KL K4Ah 4/P#P00p  0@P< R l0R  C N 6l0 <0 h0K0p0K04Ah 0KL K4/@pP #0D?oU20S 0 )#T T0Sp0Sh0H&"T0S @l0< 0Cl0 ,Y @9 15倀Kl0 <0 h0K04Ah 0KL K 4/#P@  P#P@ l0< T0Cl0 0S @T z @xP 0 |0 0x S0x0  t K xK |KPt  堂N40Q$(10(1@e4Xw 0S0Y 0 0|00x00l40S8 8\, (4#\ @  1 D T\ B!  !  80 h 0 l  D  T $ ( ^ 0003 000 s 00bR0lh0Y A  P:ll0 00 0h0 0 Q@P @P` ?00 0`( "4`#/ -LLMp`0 `0P00Y0 H D%$`(,,56D0T H<0 4 L0 P$KH  :|`#:80 ?%Kt R Xtv40d0T0p0<0t040x0 L 0 P QPX@ 0P S 0L S 08 S%KSR`0H S 0-80X0%K(T0H0<0L040P0$K%H0 `00&0p0`0 ?!> X X<: Y`0De03T#XL3 [4X0T 8<0 p<040  O?4 <J0 Xq$K0H0 {X8b0HS20d0%K*{;00-L0Y 0P0 0G "00 40 #K  4 4 8 4 <408<0@40@|0 0)"`ASRSR 3#,( h1Z &<(K8,( (,<80p@ ?@ 0|0@x!0S`0ʌ!Cb0 00 !K!  8   (088 H`(r@6dHr@@6dYc 0-LM@ P`0 0  K0CT D P0 oK0 0-LM|P@8  :8!a0 00 !K0h!K0 -SL,MP`t X@1\p #K$SRGP Zt0Z㔡 S  QP;`0 S00SX1`0Y3 a1 4 10B !S0` 00N 0P00H0 00000`00X0g181401a (KP0R000 4 10BX Sla1 `8N ?181aYcAAQABA -L@MP` pX WL K000 0`0$(0X1 !  :1P`V& U1 -;;:10 0I4 `P 1:10 084 `0 000 000;;1˦|blAuA -L$M@`LK pP ?ༀX (K Z (20 ?R0 R00 000帀UD@0;0000@<@K~K"RQP(40 S L0 0D00Yc -L,M@0 0P`<KH D  0 T00Cz S 0D0  @ K DK HKX @P@ ,{s< ?@4#K14 @P`KPDʤ!0 SA008@pbkT1 , ,0K 0040050000@@I?0S0 @?0 8?@2?/Q P@@0S   0R00   RD DKHK @PH0 0D0 0(KYcb -QL@PP @Q@ 090 0]#D R0p`b0@@%^D# R0p`0b@@ 0-@LP]0S 6K0h^ -LM1Q刡`]0S 001"](Kq崁@T0SZ@]wKKPA 00 0]0#K-K "KZ*K KSR) 0K"KQP(0l R  t0K00 R 000`] 040 0 !@!KQP0| R 00 !/ ! btd|db|b -@PPL7]0S00  R)  `l](]@T 0S$p4P 00S0C04 0S00 R @*4KhG]0 0@btd Q0-L@ @Q<  0@9 0$0@0$00PP\$@#]0$0$$@ 0-$@L \K0hi td~A 0-`@L0S \00P8!0Y 0S\\ K0hM td|d -LM1Q0S S% ` \1H0 KH" 0 T 0@(T @0 0 DR23200   (T7T1S  v bAA -L$MPp` s4P@0S1s  \P7`$IV   Q- @$Q  ! 0$P #  B X @ @0@0P2 #101(K#0 00# $  #  P@    <KZ  M@ @ R @ R  P " # <  0 3SH L0SP0\ 0 jr  P <  0C S00S 4    D @ H D@ PHFQ<X.`...P.)  #RHL RP \ *r0P0 , BR  R P  $ $ XD00PGV.   #RHL RP \ q0P0 , BR  R V  ` P r ( PX00P d$5d(5d45dX5dd05d,5d<5d 0-8@L_P0"0K0hxdP5d 0-@ML HX d \P\00P0 D00(0z ,00p0sK0xd4.?B`AAA 0-<@LlHXPq(opK0hkxd0/xd 0-$PLH@X00K0hXxd -QLM 0 00 3 KH 0 KA -L8M0@< ,0p,0#k`P0,P 0080 R 0S) y0A<0 ᱍ`PX@ {0  $0K0 # 0 0 ᕑ`P!> #PKL` P0 3`P c{0   $0K0 # 0 0) y`P >KG2"@K4K`P80' >9`1Q 0`4Q  ̗1 $00R0S 4 [`P 101q 0A  10100S+x` |V`1eeo∀`  `P1@010@00@1~:d`TPLH``\`X`l0h`p`$KS x` |V`1`eKn∀ `0 R 0 00 $0K0 # 0 0|  0 R0$K00!ِ|x`ሀ`m`|bbP5dA -LM@`1 (KQq尡 #K P4Q`aVʀ 0! `!l!0 d!\!   !@qEW0S7(W 0!!`a0    !xX( 00  ЀK0X8 ɲ@ƲP 08 0`ጞ R (@- 0Ycb|b b$cDcHcxd dP5d)A -`@0PDP@0L1P0젟&c0`PV1  zp 0S %pW4 +P sp1|<1 V   #P P0P`x#P0V|b 0-@LV1  %<1GK0hV0A -@LAQAAYc 0- L A -LMPs夃夓%CT@TT|C2 |2孟 0D0:|0x000$00@0t 00 002`Pk< 0 00040'S0 c0?o0c00400SP :D000 @0KU`PK@0\P:"p0  t0S         0 B 9(Pt0S0t0L00L0^0 <KPp0p < K)G `P rlC q z `-b?AFAMATAP5d|bb[A -L$M@Rp 0GS( `1 V Q <0  ^PP00 (K0P000 040PP000|0 0x0$00(0@0,0D000$0400[@P   0K`0X0 00@P 嬳m :pl2ᗷ0  @ 喳p"K@T D!@ b" 0S&  -`L@t0 CSR 0|P P X 0 P N 0 0! P 0& b -L4Mp`0|`0@8 ;8PPh "\D00D0 D D0KU@4  z 8PPP# #RRHL R \P   BUL0SC\0P  00 BRCVZU7, BUT DK4KPP00<0K0 0@K8K01 1 PP Q 0,Kp 0 0JPPN < ^(KU 400004 D0 4 D0000D0  0EQ QE!(Tµ #RH L0SP0\ 0 Y400004 D0 <  0CS00S4 D0 00 0D0 T00t0S00  R,0 X5dA b 0-@LPA0S DK0h9A -LtMp`0x *0|`P@|00|0D  0t0 | t h0KTP Y@X 8  " Q1HLP\PPP PEZL0SP\0PPP00PE U!pYZ5\PEZT hKXKPP F]@`ZX0000X h0 Xh0 00 0h0 W0J! !B(T|X 8PPP QHLQP\AUzHL0SP0\0   CR YUX0000X h0 X h0000h0 |0EQ QE 0!|(T嶴Q0 3SH L0SP0\ 0 XX0000X h0 <  0CS00SX h0 00T 0 h0 剴X 0F 3SHL0SP0\0=XX0000X h0 ;   AUT hKXKPPCW7@\`?P| T808|0|0V|00E?oT 2R0SP(KU d<  0CS00SX h0 00 0h0 |0 Tqt0X0 k #RwHL R P\   BZaL R0P \ 000B S CXZX0000X h0 X h0 00 0h0 @ J0 J !x T0K0`0K00dK\pK0 p0 PP QY |0\d <0 000CS0d0  l K  `Pl  `[P,000BZ0x hKXKXPP Z@P 0 0<K`P<0|0 \d |`000CSl K  0Pt0 l  `[`tP#0d0 42 0Rx  ;\ d0 0 0CS0d0  l K  0Pt0 l0< 80 4 0 $K'K'KD QPt \<QP8@00C?o2x0 \d P 000CS0d0  l K  u0Pt0 l n`P# 0 0PKz0Pt0 PY|p0Sx0SX08pX0 0x0 ?o< K2LKP ` [X0%( @ `X5dAD5d -LdM``0Z 0`` P\ `(KU$Ht&t00t0 |h0K    `U@T  8   $ Q2HLP\P`` `FRL0S`\0P``00`FV"p Vp Rl`FRT hKTK:`P! ZP$RT0000T h0 Thp 0000h0 0p B! !B(Ti0SMZP?`| U808|0 0 5 0F?o` 2R0S`g QH L0SP0\ 0 tVT0000T h0 <  0CS00ST h0 00 0h0 TT ? PHLPP\ 6 hKTK`Pu`0K0d0K 0X0K0\0K00 031`P daU Xd |@000CS0d0 & l K dK XK(Pl  \Y`G  @Q0h`000h0  A0 A! ḱ2 0R@p@ 6X dP0 00CS0d0  l K dK XKPlP< 8 4 K( SR00p0 t0D S8# SR4@@AoᩒXd Pp 000CS0d0  l K dK XKPl PP 0d K0XKPKPPpT| p0SYX08X0 @?o< K2LKP \dYX0%(X5dA bD5d -LMt0S00 K p-L MP@t0S |`P 0 gKp 0-@D0L {<00CS0$K0h<d 0-@0L|8(<60 001K0h/@d 0-@0L|8<70 001K0h/@d 0-@0L|8(<60 001K0h/@d 0-@0L|8<7ܕ0 001K0h/@d -LMP` @WpP xK0  j`010000 pP0 T b -LMPt0S03@{{Xk `0 0`0000 00PS R  )"40 0 10 40 Q,    R  (KQ. \Q 븀X    `Q V: I  B  `  pp ؀H0X5dd_>A 0-@@ L0 0K0h@P0A -LUUJ0G `0(0C t R@02&P;8D 000CS0D0  @ K  8KB`P@ <0 PtP(K(0 - b0P0X5dAYc b p-LMP`|@8  ;80S`0(0Ka (0K tK@ K 0 013/Kpt@d -LM`p|@8 ' PKӑ( ( 0S`0(0K$ (0K |K@ KQ 0 013/ Kt@d 0-LM0P @ Q||0X #0@0SX08H0000 ፔK0 -LM`0 p0`00 00090  `0(0 00CSBt0SA Q0.S P  0A?oR20S@ (K|0 0 000᫓P.  P P 00 KPP K|#QP@0| RU U 00 0• 0@ ;  L  L <$ H 0 0K`` Z0PS  8W #RdHL R P\   BYMH0L RTP \0 00 B RTOYH U 0 NY lHZ %00 K9P |0'KSR *000Q 0G, BYT KKP" wSY 0000 0 0 00 00 0I I 0 !(T-Z0RS?,0 3SH L0SP0\ 0 WO0000 0 <  0CS00S 0 00 00 0 T `0 3SHL0S0P\00 0CVL0SP0\0  0CS OV@0000 0  00000  Fa0 aF!  Ṫ0`K0ؠK0K `00 0 71rPa  000CX S@ 00 B K  PP 9 RYP0S  U T$0 0A?oR20Y00Sr `0(0l<  0CV 0 KKP V0yP 0 0 KPP@0S  000CS00  K  P z0@?SPNRH( P 0 0 0C R  K _P0 L/oP" R U  TKP R00 0K `P R0\P0P S\  000CS00  K  K!P  QYA UIP 0 0KK PP@ 000CS00  K  KP P 0 0KKP@PQPt`V KQP @`r 0 KKPP U  TƯPQH\0:f 00 0K `t)Yq0\P0P SY  000CS00  K  KP tP 0 0KKPPg@ 000CS00  K  KsP QmP 0 0KKyP@D0 ?o2R0Ss  n0 0K `P 0 KK[PP %vT >X5dA b p-L,MP |@`,0Ko (0K 0 0K0$0K0 `0@P A$PKp -LtM0 `0| /0`|0t0 H0t0H0< <D x0  h0K=x0@SX  z t08PPP# #R1HL R P\   BUL0S"\0P  00 BR"LU}, BUt hKXKT PP" PnU X0000X h0 X h0000h0 t0EQ QE 0!tt (TBX0<] p[Q #RHL RP \ lLX0000X h0  #RH L0SP0\ 0 ULX0000X h0 <  0CS00SX h0 00 0h0 t0 TX 0  3SHL0SP0\0'LX0000X h0 Q #RHL RP \ LX0000X h0 ,000BS00SX h0000h0 (;00X0  p^ Q( #RHL RP \ KX0000X h0 ,000BS00SZXh 0000h0 00,000BS00SX h0000h0 :00 X0 px Q? #RHL RP \ 6KX0000X h0 4Q #RHL RP \ }KX0000X h0 ,000BS00SXh 0000h0 00,000BS00SX h0000h0 800Z"XSRp W? ^H L0SP0\ 062KX0000X h0 4Q #RHL RP \ KX0000X h0 ,000BS00SXh 0000h0 00<  0C S00SX h0 00 0h0 700,(#X0YX  YX \? #RHL RP \ 6JX0000X h0 4W ^H L0SP0\ 0 JX0000X h0 <  0CS00SXh 0000h0 00,000B S00SX h0 00 0h0 408@$X0YX  YX \i #RHL RP \ `[JX0000X h0 ^\ #RHL RP \ DJX0000X h0 ,000BS00SXh 0000h0 40\ #RHL RP \ JX0000X h0 ,000BS00SXh 0000h0 0,000B S00SX h0 00 0h0 40HPX 0i 3SHL0SP0\0`IX0000X h0 ^\ #RHL RP \ IX0000X h0 ,000BS00SXh 0000h0 40\ #RHL RP \ IX0000X h0 ,000BS00SXh 0000h0 0<  0CS00SXh 0000h0 00000`0K0|0dpK\`K0 p`0 tPP Qx0S \d |000CS0d0 _ T K  JPT V `M P(KX5dAH5dYcL5d@D5d<  0CS00SX hP0 00 0h0 p&d000 p)|000p&000( 8@p  HPp t 1R0141 0R@t 8\ d0 00CS0d0  T K  PT@< 8@ 4 0 $K'K'KD QPt tQQP@@ @DOoB\d P 000CS0d0  T K  PT QP 0 00PKPDP0X|` t0STX08`X0 0< KLKP `X0%(0,K  0x0|@P `>LP -L M@|0s-e P|0s 0 QP$SR0s `0(0"p`SR|h `ASR>t R02 3QP #SR0|s0s# 0"`p#(T"J"a!"0(1 1yP  06 (KX""0 10 QP Z X0 ba0QP#SR0s tQ(0 1:P b -LDM`0T $0|`P T00T0 D H0KYP4  8@@@# #R`HL R \P   BTL0SQ\0P  00 BRQeGTE*, BTT HK4K@P00<0K0T0DpK8K083 p1 @P YA 8D 0 000CS0D0 X @ K  :PP@ O <K@(KT 400004 H0 4 H0000H0  0DA AD!(Tâ #RH L0SP0\ 0 F400004 H0 <  0CS00S4 H0 00 0H0 TP 0 00KPPT <J8D 000CS0D0  @ K  @P@  P<J?@P@ 0P@PT8D 000CS0D0  @ K  @P@  P<kJH@[Y@X5dA b -LTM`0`P  @_AUT0|pZP0,0`0 0PX0 T0 VK&X00X0x0` V0\0 H0KZ@4 x 8 PPP$ #R7HL R P \  BUH0L R'P \0 00 BR'!FU, BUT HK4KPP& I X(KU 400004 H0 4 H0000H0  0EQ QE!(T婡4 0@ 3SHL0SP0\07E400004 H0 50 3SH L0SP0\ 0 E400004 H0 <  0CS00S4 H0 00 0H0 T<  0C S00S4 HP\0 00 0H0 ZP05 P000D0K 080K0<0K00 021PP dQZe 80 D 000CS0D0  @ K DK 8Km@P <BIPHd@ _P 0D K08K00Kj@P0U<18D 000CS0D0  @ K DK 8K?@P@ 9T 8D 000CS0D0  @ K DK 8K'@P@ !x0@S<HHP0,K D K08K 0%@P0P D0K P8K0P <P0 HP0P<HX0Z`F0X0 OoT0BS@T0`T0 \0S`|PX5dA b -LM0 `0 (P @P   00 `0AWV0 <0 |0@K0 +,<K000 0SX040P 0 00 000 0SPW+\00\00 |0R!01S   0K 㠐 0`Sp 0 8PPP$ #ROHL R P \  BUH0L R?P \0 00 BR?SDU3 , BUڐ KpKT PP@ (H0 +0S @Kt+000C00 00S@K+@Kf+<K0U00(KU p0000p 0 p 00000 0EQ QE 0! (Tp 0Z 3SHL0SP0\0QCp0000p 0 O0 3SH L0SP0\ 0 Cp0000p 0 <  0CS00Sp 0 00 00 0 Tzp 0 3SHL0SP0\0Cp0000p 0 <  0CS00Sp 000 00  0P P0S~ PzC0HL00X'@PKP000\T 40A30p0XP0 0C00 00 0 0C0 *00000 *  Bp00|0K 0t0K0x0K00 00|61PP Q0Sz t| |`000CS0|0 / l K |K tK00P0 % xGP<  0CS00Sbp 00000   }0K pKePP l `5 0RKt |p0 00CS0|0  l K |K tK0P0 lp0 %K )KL 0 &K+K+K\ QPt \QP@ppGor' KSR0x0 0C?o20 00 ppp p p t| h 000CS0|0  l K |K tK0P0 ml P" 0| K0tK0hK0P0 ^0hS|` 0SWX08`X0 ?oT K2dKP00  U 0S㜐a pUX0%(t |0 00CS0|0  l K |K tKT`P x)FPlJPx FPY0I 000 0C0 0 00 `R`00 -Zp ZP ppT)0a夠B  ̝0`a)0S] |X0pH000 xEU0 Y0C0 000 R 0 00 0S0Z0SG 0 C0 0000C0 000 `Rp0`0 * ףP  Y0ia0| K0tK0TKT `PkTJ@K<KuPxE#A;AX5dA`;/ bD5d -LlMx0 `00&|p@p0PL0p0$ H 0p0 t p h0K TP T`X p 8  " Q0HLP\PPP PEZL0SP\0PPP00PE U SAZ\PEZT hKXKPP )E@!ZX0000X h0 Xh0 00 0h0 ;0J! !B(TXCE@?P| T808|00E?oT 2R0SP(K0 3SH L0SP0\ 0 @X0000X h0 <  0CS00SX h0 00 0h0 Tp0X 0j 3SvHL0S0P\00 0CZ`L0SgP0\0  0C S @ZbX0000X h0 X h0 00 0h0 J0 J !t ZT0K0d0K 0`0K0x0\K0 0PP GQT \d |@000CS0d0  l K dK Pl  `VD P*<  0CZ0t hKXKPP Z02 0Rp`pp 6\ d0 0 0CS0d0  l K dK NPlH< 8 C4 @p`dK;(SR00p0 t0D S8#SR4@`p`Foob\d P 000CS0d0  l K dK Pl @P 0d K0PKPPW| p0SVX08X0 p`?o< K2LKBP `CX0%(X5dAD5d -0ML00 - K -LtM`0p0\-|`@x0P0x0H  00|0 00t0 |0 t p  h0KTP Y@X 8   % Q4HLPPP\PPERH0LQPPP\0P00PEU# w? R4 ;\PERT hKXKPP" LC@`$RX0000X h0 Xh 0000h0 \0 B! !B(TWO@&C`?Pp0V| 808| 808p0|0T|00E?oT 2R0SP(K0 3SH L0SP0\ 0  ?X0000X h0 <  0CS00SX h0 00 0h0 T|0X P0 3SHL0S0P0\00CU~HL0SP0\0  0CS >URX0000X h0 X h0000h0 EQ0 QE! mX Y |P8PPPR QHLQP\AUHHL0SP0\0   CR >U X0000X h0 X h0000h0 |0EQ QEz 0!|(T"<  0CU0 hKXKPP U0   AUT hKXKPPZt0X P0 3SHL0S0\P00 0CUL0SP0\0  0CS >UX0000X h0 X h 0000h0  EQ0 QE! ὙT0K0d0K 0`0K0 0\pKp0 0wPP QY~ p0\d |`000CS0d0 O l K dK @Pl F `APiU CP QHL0SP0\0 =X0000X h0 <  0CS00SX h0 00 0h0 |0 T9<  0CUw 0 hKXKPP (U0k4 0R | 9\ d0 00CS0d0  l K dK @Plz< 8 u4 r0 $K'Kl'KD QP | ptQQP@ Iop0\d P0 000CS0d0  l K dK D@Pl _>`P 0d K0PKJ@PSP0Zp0 |@ |0S%YX08@X0?o< K2LKrP \d |@000CSl K dK Pl  `@ P@X0%(0d0 $2 0R| t :\ d0 0 0CS0d0  l K dK Pl< 8 4 0 $K'K'KD QP tt \:QP6@00C?o2|0 \P d 000CS0d0  l K dK Pl @P! 0d K0PKPPY|p t0S|0SX08pX0 | ?o< K2LKP `W@1X0%( @ `X5dAD5d -LM40 1 0000 0 0  K b -LdM`00@X0 X0 `0|p\ <ST0 X0(0d0 0Pp `0 P0 V ``V$P0S lc0 列! H0 0C0000 0`C`Z) !8888"`0S X0 0?R:*000H0Kd QT0`S4 r 8 PPP$ #R1HL R P \  BUH0L R!P \0 00 BR!;U , BUT HK4K*PP ?U 400004 H0 4 H0000H0 EQ0 QE!(TZ4 0Y 3SHL0SP0\0P;400004 H0 N0 3SH L0SP0\ 0 q;400004 H0 <  0CS00S4 H0 00T 0 H0 4 0k 3SHL0SP0\0bD;400004 H0 `<  0CS00S4H0 P   H X !         $ X0(00D0K 080K0<0K0p0 061ᑹPP QT0S\ 8D 00\0CS0 0D0 $ @ K DK 8K`P <>P(K<  0CS00S4 H0000H0 P@ P 0D K08K0K`P00\0 U<8D 000CS0D0  @ K DK 8K`P@ 0 00$08D 000CS0D0  @ K DK 8K`P@ P 00S`P8D 000CS0D0   @ K DK 8KP <X> P8 D0 0T 0CR! S 0D0  @ K DK 8Kh`Pj@b`_ 0 &KY0@S<->HPYS0D0  @ K DK 8KF`PH@@0 &KP0```pp-@(K, BT| dKTKT 0@P# 7'T T0000T d0 T d0000d0 |0DA AD 0!|| T(]p00S17?@p0 3SH L0SP0\ 0 3T0000T d0 <  0CS00ST d0 00 0d0 |0 TT - PHLPP\$p dKTK @PT0t P Q1 #RHL RP \ (:3T0000T d0 &  @Q0d@000d0 p01 A0 A!p p ֎,000BS00ST d@PQL0\0p0 t0S+ Xd 000CS0d0  ` K dK XKd@P` 6^WPP Xd 000CSST d T dKXK%@PPPWPUy p0d KXK<0 0<K0O@P<0Pp0  t0S Xd |`000CS0d0  ` K dK XK!@P` 2 0RaX d@0 00CS0d0  ` K dK XK@P`@0 #K (K4 0 $K)K)KD QPt \,QP(@00C?o20 |0SX 'KSR0p0 xp00G?o20 pWl0K04 100 uPPl0\0p0 0pp p p Xd P 000CS0d0  ` K dK XK⠾@P` r0P0 ! 0d K0XKPK⥮@PePW|` 0S0SX08`X0 |0?o< K2LKˮP@  | 0Q0|0 \G-U @@X0%(x0t 0C?oR20S09*  n)<@K;j#SR8$SRH6 1p*@P p0ST0  n  p p0p @0 %| 808|0S|00<0 C 0 @00L3 0  P0D 80aS0P0T 0!`V 9!P 8 $00C$08A>C P?A AL3 0  B  0!000 AAL3 000K\00S  s00nRP #K ?@ $K@ $31YcTU v@.AjA -L4M`p P@?txqp0!$K2\%0 R 0?!! ?#KT80< L2)L<0K b<"1>WP 0` 00\ Ó\ MT(KZ 0  `$Kz0TTU p-L M`@PU Kp8T L\UP!P TU0PCP -LM`@Pp 0T  B bȟ"30]:0 0C0?oR20S $Kkl -LMp`0HPS`8@ 0 0K 0p0 QPb 0p(`80 00(`` Zf k  0 00C0 A`Rp`A L32  B \%X1R/=S,T @Q0PuS X0 b```Wڨ 4 Q04  QrY00C00ST0T00 ! B !0 0 0@P800c#K`pUp` Z"P0 0S@P(KU T -L4 `0pS7 00#K ? $K4儷=S$$- K0w0p0 QP405005 00 080T  `p 0 L30   <0: S 0?0C0 `Rp 0 L#00C0TQ X  0x0cR1 (KoYcTU ;Av@eA -LM0 8@ 00PS  A0 T!埶``0 C cA>2 C`p< D4@Ĕ#c 0m 0R0= CP0 00 0S ?m000 ڻP ?m 0 0 00000 nP00Ȅ0Sh0h !`a 00 00(K0 |AAD70 -LTM|l0 h 08d T0H0 ; 0 d0: SL0 8@,0[ D0 `0dm0E _m0PL0040 T e,`Qw0 00 V-Q80` ,QS`p?3mH# L0 PS0@3@@ 0d0 0 00 l0(KLr P0XpU Lb ^pX`U ? 0l0 00 00Q0C2S0!XP0 00C1HS0UT0 00C1ES04`0 0Rc4eK@0 @4K 00`Vp?l#KR0KeK0< 8 V" o#K0l@0PSiUP0 ?l0D R0P"0D R240P64`00`WLP"\T Q  `RH# R0`B0LP"\ T Q `RH# U0L#" X0L34 20X040 cS/ 0C0,HH h X<1@ PR@0LUPP1&0AA -L` Pp8@  h`0 C c6'`p\ MQ 0!JPRt V0  ? l8 ?,`pZ 1JP ?k ?k,peM` A?k0"WU`pruL Q8 `p0L320S80P80` -L` Pp8@  h`0 C c6'`p\ MQ 0!B0Vt V0  ?k8 ?,`pY 0剑 I0 ?{k ?~k,pL`? Atk2 W U`p ?]kL#  0R80`pL320S80P80` -LC< D4@Ĕ`p#c 0h 0R0000 P T}) 喱0xy\%0R1'#K#K0"K08 4姲 1KT0L0 U0SBK ?h@ | L@0 8`2\0 0\0CP0 L3T 0 0PQS:= CP0 0 ˡ0S S< RD4@Ĕ# 0hAn FP0 80S 00`40K000 0 0 0 O0PD0 D(K08S <0Lʟ0 x0 ?x(K#K 0R ? R00T0T0 \5TS@00@  00@  0 L)Lß0K2 pb<87"N0PD0 00将0p0S 3S6&\Q-R (K ?h&K 0Y`?T0X0 0S̠ &K ?'KZ[ ԆKx08@(K 0&KQo A 40Z A0C4040T0409 0TAS&K ?$KZvTQ @0@S  |0 0s0cR1‘T\0KP000S h00h0 00 00S T8`4 A\<`)A lQ6^#LSR| @'K&K܆K 0'Kh0/0 X0!.&K 1R R P"M &K$K܄K 0&KH0/0 X0!.$K 1R R ^"r nH0܄K/0 X0$K1 R0R  0( $00C$0 ARA\ L30  B $K 0$KY0P DJT!`am -L40P 0 0h40o40 , 40 00S0D0 #K < D4@Ĕ B#d 0gA~ GR00` 10S u001` 00@0 P0`pR009S 0t0S# 00#K,P000Sh00h0 ! 00 00S! T04 C)C2 b16<"# K40 00 C 0h4040 , .40 00S`@ 0\4gL0S 4I|AATAw@tb]AU YcT>AAD70A -L@@ #K廯0KL`P 0h 00Q Q H(K 0 P #K%0~IT9w@AU ` -L,MPpḠ@ ?e|0\Ŕ0p0!#K`0!\  ? `0 c0# S.Q,QQ3, V@@#K[0K&L`P 0h 00Q Q {H(K 0  P p#K0ITFw@AU -L M`pḐ@ ?Fe\ !tQ\ ^  ? `0 c0# S.Q,QQ3, U@$K^  ? KT004  A0)A1 `2< (KKP(Pp 00P Pᵏ  H\ ?d@ TB@GTU -LM|P 8@8u Pp2 a Q̎SQS10 \0-0 UQ 00 sS 堮0S0 0+KR0 P l0 L1<1̀ 0 ,K R00lK00 +KV0000SI `p<96>Q,P850%00 0@50L5 0 SY60T0p00,K0K0000000 0,K[P P B2 b061b `0`0*ˑ0*K' 00 00S  XH+K R0 KЊP `L<6 l0>,`B SR0SE85@uL0ppX 0S 000+KJ0To0p0000+KP0K0000 p0+KP*Ka 00 0 SR0@u0ppL0p0TE0p0000+K&0K000 p+KPr0S 00 0pT0  C)C0 `012< +K0K0|0K0+K(0P0 Q0t 0C0 01-0m0`T00H+K0K00 ` 000K00 +KP0K0K00 000p`0T0` p C)C2 b160" &KPGPt0 0ap 0 0 00K0 pЀ |K0K00000b0 JP00W0 00 1 .K 01 .K0 `F0p0 0p q0 0 0 0K0 0/K P HFS0T0 R 0 00000+K^K/K000+KTK0K00 0000/K +KP0`0 0 00 0  0K00 0000T0 C)C0 b201<"  P E00 0S㨠`K0V`:0Sk !`Ra 00 0a FP0`S0 p0!00 FiwFg 0C.K0OzPm0T0, K002H00+K0K00 0000+KpP E0`堐@0S 00 0000T0 C)C2 b160" +KP000 00, K2H0 a!V ]F kE0S K 000+KHPg0 0  00 T A0)A `12< +KL "|K K 000 00 0<PX00 0 T` ?.K 0F0 000  c 0SQQ ?Qb01,).K0 00 \5S 00`0 2",0KK.K  ?l A a2E0K00 00 00  0P0- EJ0 S00Z0S 0S&0  00 0`p0|K0YʰK 2  0`PDD ,0Kb0K000000%F9HP b H00 1}E0K0 # 000  0000 ܀000X0S 00P 0kD(KTA-AS0S0 0+KR0) P l0 0L11<̐ 0 ,K R00lK00 +KV0000SR 00`p0 <>68Q,P85L05܀%0@5 00X00X0S9 0Te0(00,K0K0000000 0,KPP B2 b061b 0`` 00 Q0 0 00 00S P + D+K R0kK P`p L< l86>, `\< SR@uL08E @@p@pT0Sz 00@0A00000000T0(0000+KZ0K0000 p@0+KsP"0 !SR0@u0ppL0p0T0(0000+K40K000 p+KdP0S 00 0pT0  C)C0 `012< +Km0K0|0K0+K$P(00C0 t0 0aVg0pT+K`0K00 p 000 K00 +K#P0K00 000`0T0` C)C0 b2160" &K,PDPt0 0a 0 0 00K0 pЀ |K0K00000b0 FPy000 00 10 0W 00 0S B0p0 0p p0 0K0 0 -K㠂P BO0T0 R 0 00000+Kt K-K000+Kj K0K00 0000-K +KP0`00 0 0K00 0000T0 C)C0 b201<"  P B00 0S0`pK0WE:V h0dCh` gCP0` S0p0 XCwCu0SJP}0T0, K002H00+K0K00 0000+K+`P ?B p0p R   0  T A2)A b170" +K,P000 @0, K2H0 qBB0S 0 K  0000+KEPx 0000T0 C)0C b0+K |K" K 000 00 0 PU0 ἠT` ?-K 0F0  c 0S0 QQ ?Q^01,*-K0 00 \5S 00`0 2",0 K K-K  ?l A a 2B0K00 00 00  0 P0/ xB00C0 0S00R0S 0S%0  00 0`p0|K0YʰK 2  0`h P\AXA ,0Kb0K000000%FDP0H 00/B0K0  000?00` -LdM$K0 0P98h0 0#K0 S) R04#K ^K00K000 00` $K P=00 55!t20t20$ ;60 0R彧t< <80!! K8 8 %K #00&0>@P0咀@P 0@(K000p00S0H0 0Hp p0?@l0 h0S@T 0000 0q_T0`1\0 0t@ TU0A0@0SH0 0 pH0 t$K `N0$K 8?&K <0` <Ȅ"!K0PH0 1L0 ?K'K%KKR09l0 R00S 00SapH0a`0 0000C0#KS] T0 C) C1 a260a0`%K!j  R\ ! 0H! 0 R!L BKK % 09S0. S.0t0S # 00 0$Kk00S01 0L AK0 0  K#K 0%K&K R0&KL0`F0CL0 S0 00D0C00 T0 C)C@0 b21<0" %KP ?oX20SZ 0 9@o0娂?h0S 0@T@@Zh0S 0@ bWA -LM`Px! 0@pW 4Kg 0 Wp0 P  $0 Q D  0! 0V`0 P ( ,0 Q @ $ 0  UP0 P 0 40 Q$ H  0< 0 0 00 0 0:0 0 K    -L,M``0p(0|Pp<` ?Kp`T0 C)C210K0 b60" rBP 00 0\%`0PRx 000@? [ ]X0 ?(K[,f?p TT -LIM.K0 0 0t-K A0ASR|@:.KR0*Q Q^^P hQ KQP% 0҈Q(p\ 0*Q  00 00  (K!)KQP08P =*K .K000 .KR0rP \>, l QP!Q RQ<Q` l \6 `Q^ Q^SRD K= C0H`KWV 05 ᠈K0 V 0000 0!P 00.KUZ C.K 0 AK #0H00,0,0  A?K  ?.Ki0 0000 .K R0R!P.KRt0S ᩧ.K*00SK0.K.K0P ?`Rp `60> P0 W" 00P0 1E?K R08# 00 0000S0 GK-K 0-KZ* 0EK A?KEK R0q/0 AKQP `0S1{ 0!C?KC?K 0 A?K R0 Pp 0n1 >p N:.7:QPb:0.K*0S.Kb A?K R0 P pL< `l7:6,QPQ:0 RU08%1 "6nK60K0P00Sg 0qP  \2, 0l3 Q0 R9Q0 U0S<0 /K R0 Kj< l90>,WVb:01 L lj0&jn<0 0`j>0 0300 0<0 /K ?WVp1`1.KWV`pH0C20000F0.K@0d$ 0`p0H$KnK4p0`KV0Z%0'00/K  0őP a0 0000 .K R02P R8@eL`0K0'?1ptx1 ` 01E?K R00#SY 00 .K؅.K.K.KK* 0 R K00Sh  Bh  ! R0`paN 00 00 RN !G?KG?K 0? *IK PE?K  0 L `l2< 1 CKI?K SR$158e50`%`0@55`0L05`009S t0S00 # `G?K t 0 R  p!pq-Kd KE?K  R0q1GK' 1CK' 8@L!8% @ L `NVd009S t0S00  TC?KR `0 )-Kd KFYnlwA00S1/P11/ -LM|@i8PpV``P (K B2>0`` b` "<1`P (00 0ZY9(Sڂ;` K]8 -L8p` 9@00 $` B2 b>51RT H B1) B a25>Q@P8PD0<00p0!"000sK8P9 -LM|0P8`pl@T 0 <p P $KT 80 B< a31< QR0QR!` a31 Q8W7U X00F7W080 H |`PH0 wp 08q`P 9SL09S 8`_Vc0P S0H0 bA -L(K8|`0 6S \P̛8(yE/ 8 !Q0A E?01 PEP @08 2B0I> 000=C ?}RP0 C c00 4 K ᙀP l咛 0#K4Y  0 p 0S2 0000`8 ``L00L0l408 1H0 @0B20I> 000=C ?9RP0 C c0H08 UP dOV 00D D00p00t000c# bAAA"A,0HA -`0Lp@M PU 000V t$Kkt LR000 0p Rp9S000iPx#,0 -LdM``0|@0h 8P00p0  " *$K0, K0"d l0 h0 R Kh0`PP0K0<P D0 4D0pD0 2D0(KT0<ĕ8$ Cà c23@ D0 P00@ c6 SWQWK8D\` 1eK!lV C dK\  c0P T KQP::8"3H L0 $K ?WV*L0@E@DD0@L0@d0@ 0l0 0 07P0< 0\@D`00S`00DS\0 0`0h \g0P<\0 @4\0<0 ud ,0K @# l 040K  0 @ 0 7 0-@x L0P?Q00S R0 ) ) d l p t000,R0 ) ) X P  0 -LM` @6P P 0 WVc0S 0$ 0>R 0 #R0PsPP 300KC-8P`@@8 ^ T q   Y | pሀ8YXw@y@|y@ -`0LSꄶ0h0@0,0@o10 0000000B!000!>qA -0`LQ 0 00ܶ0o0! 2B1   P"A -0`LQ괷00|0p0BBA -0`LQL00000BB͙A$ŐG-\LRPPl@p@`rpnRSNh$Up`Y!Vࠡ΁pppΡ~ ^'pBW  ‘ @$@N`GoHV#pG  UP!W !! B!^!0B1$5S P#1Ѝ Xppppp  H @D!R0C -L MP@T00040000 0= !`0 Cs cpcA>2qC 0#KT0PĔT$ 0C cp<` ?Kp`T0 C)C210K0 b60" 5pP, q` :P8@ "$K# Q`$K 0 010Px040|`00d0L0 0L0R(KT6d6dy@ -L\MH   0 D3p Q0 `PD0K0PL0 $KHZ0PL0  $KP L(KH0|@9 S Pl P PԄK` @h 0A@ 0hh0AP^ 0ah0S^0s0#0%0%*|000唙0 Qt  0 XQp  00 %XQd0X00YPЈYX Q0(l!lH0K  %t0 00 R l0P0\%$1R<K1Y#K#4 0L *HX{00@@y!0!0 $KP%K0X0 l0P0P h@0 0%Kdt00SH\娗  0!Q t !r@y@ A6d6dTTAA~0@-0 :B S60B034AQ\*=@C0$0S# 0S 0S 0S ,0S \0S \Ő0\x0à"ĠR S00 \0P S0 00\T S8@^`\H|L|R3ST0RS 0T -PL1P@X 00\ Ó\ ..x*.0哊%V<K TU 0-LM p0Sp+@0 00@@ @@@IP0 00@@ @@@;T0@0@ @@@0  .K0hK0xb8A6d?AHA 0-< Lp00CSp00$@YWK0hSxb6d -LLM(0PP T Y 080 GvT0P 8kQ8łZ x@?>L0 0h/`?p?A 0$40K04+8310PD L0 {4 0LL %L04! %-5\%`0 RR  {0(hpVW0#03 W0S P  {0Y 0R$%$5R, ,0R?>`CL3 L3P3 P3H3H3=0T3T3 L  {0800M0P<0 ,(5 0S,0 @0@0,00T`mS> ) %< 1S (030⿒(0E 0X4S 0 0X48p40pA2LEX$5SP0F0KHp 0HPP pPpuP8 Mp00J`800X40`H` ?$KT0HL C)C4KL 0b03"`8_00Pp4 0 L0 {KL04,80p$%!0, ST0P ZPP |`?I%K̟)# ᜀKH00H0 ` \5S 00ß0 2",0KKKx ?cI`0 C c0"3@ D0 $K ?KT0p C)C4K0 0b83"8/P o< 03H<0(K# 4 4B,oMy@`ATTQAkAoAA -LLM0pR`@00 p0Pb08 X 8l`0 t0 @@8Op8*W>(0qz`T0 \0 BT0P<0 圐0P +000 @t 00K00T/  0:$08?/pP~00K0 l\5S(hQp($KSRp 8&VJQ -z@0 0J %h!VQ % # 3 Q RP zShp?.B$KSR@ 5  (07<0 O $KS> ) %< 1SE 0X4S 0 0X4ph00 S+0800 0P<0 0L0 !=C P0T0L C)C0K4 0b83"8/pP040$ R:X+L000 L00 5  0L0S000004pA61$%,0P Rq0T0 y0H0 E>D Ld0 H0P Si$5SD0P30ÜD0, H3I4tS9Ӭ4հ4S@0Ӱ40T3X0`0H0,000(5 0S,0@0@0,0P000 040(0:(0,0<,0X0P0`0 0800t0D0t 0b0?o0cH0T0 0CL080P0040808嚝L0SV (pu 8p(K(0<<820n(020<0 pV00H 800P S0H C40œ d0CH0ßT00K C)C 0b"838A.pP000 0D^ID  00D0 *H 800p 0H0 ]D$%0 D , R^\4S  5  0 00(00 (0pTLxT hx80P <`*V P x\x00zp:<0 Cp(a`p00K00$p` 0h0+`04pP0 5h 1 5000`H000`\%R=S04, 030304040 50GH0" " 20 5X f*p(KA'T -L 0 @[ b@YcAQAAoAAA -@`<1LPpሁP 00 pP==S UP0 <=t0S n=p= Sz#k$%0,RL1vhvP uTu00(0:(0 b -L$Mp`@=S =S ddB4K@CV00VP0` 80 0 K04gCP+4HCV T0Sl0S o 0V    zPP^|=S 000CN  PP(K8o P jV0PPj 0   z z@NA0Yc 0-@` L( # T0|  Q  `000P05/-/ -LM|@p #K0 P80 0` ` ( 0 00YS*9  0 00 ᱒P9 ;909  0 00 ᡒP9 ;900X 80S@@0S =4Z `0 }00p#K1/ H@RP@ (K0X } W`0 0 00(Ko/ -LlM00| P0 *  $K04& K*QPi$KR0K0H0 )QPvH0SHX dK =T0 00L0 `08(0H@0`0 *#K= C#K ?%K#KR K0 0K`p< 00pH0`K#KP0fKK#K 0'K#KR0OP4p \7,0p `l&`QV.Q0 R^<A l0l \nQ|QjQSR8 K#K%K0 KSR#K, pKL0 0P00#K R0 0k pPL0S *#K#pHc0 %K#K 0%K ?{0S)T0Sp H p`$K 0#K#00 H0 0#0  #K0 {p  )៉ #K= C%K\ <00`0`F0V`!V #KKR0p#KKpR0ppWL0K0D"0 K 00\ >0P`p#K 0%KK#R0 0oWT L PpP; H0C2000 0 )#pKR0 0oW#`0S`<0 #80 (CL8QPT f00  0 #K 0{pP? H0p 0#K P0 (Kݎ |'KP0 0L000 'K1/p׎W ! 0-L @P帕 P000K0h -LM@|Ppy9S ʸ;S ` ( 0 0`PQ 0 SL0L0vV0|P|0* 0 hK6d6d6d-/-/-/-/-/ -L|M|0@ p0 0p)UT`)P& p0*UT#*p0, K8P00"t 0 ^ p0*%K %KK%K R0R'K0 <P \$ =(KP\X 0Q0 a" QP3QD D0 UX0S1@0 $K 0&K`d#K A" 0a<3H0 1L0 $K R08ŕ%K܄K SR4:0@\00 0@Y0 1܇K !0X ܄K\ %K SR't0@000$K'P<0 @D\ RT \@ 00 \WP <#< T0 @@5@L0@&K R0$K 0 A a21l0 h %K܆K SR*T0@ 0L t ,0K # 040K  0 @$K' -L$MP`t |@R0 p0 (Ko")QPB0SB 0 6S (Ko*QP:  (Ko~꼠080 0S Y  ጇ*$K 0#K$K R0#KQPP H0 C20 0080' P (K -L\M`PX0 0T 0|@H0 0)YX R 0QPH0SH} T08P =\0 *&K0P0 Yd P Q2 aS8 8̎SQL < 0< ULpA W p!Q`0KӜ Xp  1/P@ ?*QP 0* 0 R=* Um0P0 #K R0#K P 0 l Lh h00t !4!S0P00S 0 8n0$tMA bdA6d -L M`p|@z렀$`MPP0PP1 BPP$SMP T~\$Y00ҍ  K6d bA 0- 0LP tͅ*\Œ`\00Q0VQ08LP<<80=40$0 @0`bAT6cJB6d6c0@-@P0 P 0SR00G- MD!A`0Q000o0@$@TP%P`A @TP@ @Hp0 @C c@>T @@@T PP@ ЍЁX@PP`@ P@ `` AaUT# H`@D0C4c@ c pSjTgQI AAB_ CC `cJ9F @C@``VAp@TPPA Q -LMP'K|`0U ` p0 @P  000DD0@0 ܇KY X 0ZW00 0R|  1L `L l<,60> \HP pP`P 0 00 (K07P| x0 0L @ `20 0000`pY X 0 S0 !1| 001/P|Vl`KWppK'K0P0 0 Qp0 0> 1p `p00CSp0 6W 0X &000R00S 0P X0L! A a1<80 00 6SP|0cx0s#L A a1!<60 0z1Ѝ!F)K K'KSR 02 W>000000D00)Kv pP -2L0 C c38008600<0r2t20t2QP  \뀀 ;`)K* H0SWI00Pp .RQU 0KK0D P00 S 0|0 !C1!01/P`H'K 0'K000RЀ   U R 0KK0D P00 S00| ! A1/P 'K 0'K000 00 U 0S `pY X 0 S0ሁ1' '1/P 000 bd -LM0S |   0S ,   0   C K1 -`0@00L|P`06/ `000`06/P _00 -LHMp@%K`0K00s #R 0|4K1/%K0Hg#K0K0K" 0 R &GP :D0 I6@0 $KP0KD0$KQ0)jT0 G`K P?KK np100 0@$KqpP }j$K |0K0   $K1/pK|0, K0 $K 090`0,0@09#60 -PL0[=0[S< [.RS#SR QP00; [.R00S P -L\MP2p0\0 `0` 0@\0Z1d0 h1P X0 h |0T 0 4 K #1/` d 0T1ZQP0 DC 0d5H L d"83 @0 4D0 ?&K\0\#KDKK@RPP &KR DKT !K@PVDK 80K0 0L 0T000P000T000P0 @P0 0 08 S `0`F`00`0`0 dPehTXbh(Kdb -LM `p0|@l0 0l t0 00d0 `0,0P0 0h0t 0h0OlPP90  `0(0 0JSPl00H0K0000 PH0 S080l00SP~S0 8000 0000 R00S00 00000 0\0 `0ZD00C0 \PU ?SU .:P0`P0 @0|0 `0 0 d00C x0 ?)K܉Kd ? *Kg6d00 0h0 p0 `0 `0 S0S0`0\0` 0 00 `PPu"0PKP Pp640 `0PP F0` PK00?PP (K\0Sx00Sh00h0 P0000ഐYb % R  0 P0W \ R Rg | R      IRڐ`P[\P]xh h R  Ap R R= | R  R6 0 =P0/| R@  R=d0`p 800`0 0\0 PP 0S| Z08S0S u@$`0 d00) I I )` ` P  ` 0S ` 8  p \   dRK`0 !`0| `R* SR *\#L00S0s 00 0P{0S Zyd0`0c\0Z00S t jPP)%KK#K#QPP! L0K <K`m]PPL0l 00S5 9S2 t jPP \0S iK*K`p'5d0`0 `0\0T0Z`x000HT x0` dPd0X0p0T0`0S0`0 ZZ 0l00 QL0K DK`]PPL0K 4K`]PP9ZK`x000T0HT%K$K#QP{[Lp t L`TjPP9  |0t j0 t孃P{ P;[ZZ%KK#K#QPT[Lp l0L0P00 {\0 bdbAA -L,M@0 `0|P,p0 `<0 0@*QP  0 R8 00 00 040K000K0?Po0@080 pW Spppppⴠ0J Z<  R R) <0 y<P<0!pZpđ$,,(~0p p W0p 8  Rppppp0C D0 6D0Z0đpɑ80S0   0 54i 0P0 0 R ?SR *`@ 1/ (K葀@AA -L4M @Rp0T`0 |`,0刐H0 0L0 0I ,,}@K0 R P?5/PP5  ?*\/ 00 0*.aH0崐@0 0 0 @ D00C00L    5@hP<K>`0< K00@04/UP(K!0 Pꠀ@A -LMP@|` (K,0K. 0?pP% ,0,0 T 9 0C8C890 00 0(ch 0Tp0 0 0 9S`00003/ K0 B?pP ,0R     -LMp,K(KP@ `P%(0`0,0@ (0 9 0C8C890 0,0 0h 0 `0 00 9S`00003/ K -L@M K  40K'| K謀@ -LM|0#|1 K -LM|0|| \ |0 00} K -L$M|@P)|@`|@\yᰀ @|@@H@@ p0} K|| 0 } -LM||)@0} K 0-@LP0S .K0h# p-L M`@0K0! /PP PP j|T0 00 Kp 0-@L,^|0*0j00 -@0 LLMp$KPP Xl|0`#SRX0`(K0 00` ` 0D KL `P`0,0@2`[1`[V `XP3[ S0|8 QP$K6j0P@P0K LK/ZX XX0SP]@P PyXPP@t0S XP|0*0P.. -LDMP| @ <0 9 @`Sp0t9|08 )0 | 00 0 `000p07/pP080CoᩒZ VX2 | 9S@09|0)0 | 00 0 `000p07/pP | 90C9|0)0 | 00 0| 90C9|0)0 | 00 0P4 'v |  0sp4 DvWnXZVP0 p 0 G 0R0RQW W R: `00 00D0 0,0K #000K 0 ?P& 0p@0 0080 00 G 紐R`< , @RH0 <0 D9PH0 @  R BR4&00<0| 0 tpP V|009 ?o200 t{(KXg | 90C9|0)0 | 00 0 `000`06/Q80S0 X 0|p |09#60p?|}pP4Z Y; | 90C9|0)0 | 00 0|9S !0| 9| 0`0@ 00 -  01/X 0p00p0|0# |0 0|0@0  A80Sp8 I0 pD00C80080 8 0 Zp6dA p-L MP @ 0| `P |09SKpMy+1/ -LM0 K @ $01/P00K 0-LM@K a0 WXPP[PP V00K0-/ 0-LMP0@ K $ 1/P PF00 0| Q  Q V0F0K0 -LMP 0S 08 00 000  B;s0 Klb5A6d/ 00CS0/0mtlb6d 0-@PL T 00 -LMp00K00P08 ` 0`uXP0M[P 0*V (K000|@ 0 0 009 R0  09  <101 00+t|0  p~P9 ;900 0 00Qd0X0 0`000`06/P  t` 0 0 8Y +tZ000 0 90 000 0U@6d 0-@LPᏼ0S ҔK0hǼ p-L MP 0@| 00T ]`P0AgKp p-L M 0"| 0@0T E`P00 0| 00 0#gKp0| 0 0 @o/ 0-L0S`0|00@0 4/0 -L M`@|P t R02& `0(00Q t  }ptP2 I20@p!+{0 } K -`@L`0|P00p0 7/"!#"9:#:0900 000#"00St00C=S70(00000 ?#00@00 ?$00P00 ?%0 $0`00&0p00h0+40 0x00|0t0S; S8`0D000t00$) 0(S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p00!4;$( -LM@0S30s0!p`SR*bWV&00s#(SR0sx0s|0P s|`0T$: ` (   (K 0# #88Spp 0ta{0 |PW0|0#880'00 Rd0X0 0x#0 0|0 y0s+ `0(|p0y s000 0 0z 0 |P00 0 0R0 t   尐0 Rp 00 00 QP t00CS񟗙xB1pB1B1B1D1D1B1`0(00w 0Pw#SR|`1QP-&SR)pw! `0(0_0 T|@p+tpz0 "|P 9z:'zp 0y0 00p>`0(090v00 z0 @{P*#SR `0(0 00 0$SR 0 ` ( 0 0&SR Q#0p L `0H 800p07/P -@ p-L M@`t0S | |0|l0 0 0T0'PwtT2SKpP:S -LMp` |000 U5  !%!@%U$`M 80 Q00K0 B0[<0 0C"T @! B!0 Rʱ@080 !X0 w% 80 !@0m%W0$0U& <0 P0P0Q0 0TT TXT0GsTP0< C0 >8 <00C 8@0D CH0DP0 -LMH`z V@u B3X:`P`R  \ #\PRP  ["V 0S* 0S  o"  0D @HPH (K  P0S00000( PP e0Sp 00000垰00C0MD0 011 01S     0  0q000p W  B!X$00CS0000000 $00Cs00K0 0Dk0S 0"Qذs0HPD0 -LMP0(0 $0@S00S`p0S 000$00Cs X(0K0 0 /( K -PaL`Mpկ@儐K0%T00S $K,0TPKX0 , $0K8@#,0(0S,0 (0, K, 0(P(0 FPᮯ\0S,@ @S X , X P0,0S( , ( 0ݯ0SP2ׯPᒯ\0,@SX , X 0,0S( , ( 00! 0 R00R0S000Pp0000SUP0SP堯7d0 ! 0/-@ !! # -PSL`@!V 01P 0 7 0a 0! 0Q000 !  !AR !  B / -LM@P`p 0@@00@0 K -LM@P`pP00Kh4Pp0 K / -D ML 8 0 *0 0 00 7d Kr1A@9d -L fP00@9d 4f@9d -`pL@T) 3S& 0S ᝮ 0SP (PPծU0  0S 3 (僮30330C3Ὦt=dA  -L`P P P% p#  PP @L0 03`03Y3S(8<售3 03勮T 凮t=d 0-@ LP0L0 00 -@L`T, 3S |@P& PU $30C300_ 0\o?3 03<*8, 0S X00CX0t=dh=d;d p-`L MPK%@T* P KpP0P0P@@# P -@LP`Lͭ7 堮00Kh t=d -LMPQ  5 K0s/@-8000CAT <01D A  @_ @ !R`UT !0 -L M80PJ#AR0<0a@D@Ab A 1T-X00 7 \@P`.  !00 R !@ A@ 0`v!PQX`V00C00S0S L  ^ WV @V000(K`;c -LM#K0P0@`p80 %@5]1s #K6P40#00gP#KHP 3@03303``@⁣1S 0V #K*0#K`80V#K6@P-#K@@P >:ҬY 3031S40#00 P603033@03A303A 030!0 0  GK嘬Y 3 N PJ凬6Ŭì303} 0T X#K*0#K@80TSY0` (K AAt=d 0-P!L M`p&6:'fpH A 4``008  UP  Z ЃAX H( 4 I/o0 KXD0"K4FP@< U80080 0 ^0W  |0P @1@ASH H0L L@@O(KZ X40 #P404`@008`H`,@ZPP< zh@;dA@;d;c0S(0,#6)H588qgh0d S  d 0`qAAt=d@A -L@P M$ K@"ş 6, K  %:&p, `弪V V v$KD孪,3S4(,3 ^, 3K03t=d -L,Mp` KKCAT ^D  H &".C280 40< 0 #2>D0 B2@0 H0X Z^ |sx!pX0 CX(Ko譪@0AT 0KL0 RPKPPPUKSRPKSR 40Y 0S0S   [L@1T0 P P HT0P  00C0P#KR0CKƟ`FX0< 0PH(Kh=d;d;c -LM0@sR 'PN<H000aSL (qL $ ;PU2 0 O+#AR*D @D4.XKhM3 030 00Ʃĩ(0,#63<MK(0S, , " 80S< < # $K 43`8 4 !( R8 4 !(,8 4 A8  4pq,p(080S(08 < 0(@<00"S040Q<400400 080000000000$0 0X K0 >0#600 1<0 00M0 "K囨! 0 D  0 01 D < !0     0 K %K1/pP800X0 00WD$ 00 00V KQP; (@A1 0B!5D Р80(K#R L#R DY 0D02{t5vX0 6L0 /0 L"p0PPDE3,PPQ|bA -L4M\ 3,P 0@Pbs3@ C3RK !#KK0"X 0K 0K$KP 0l%K#K$K R0" 1 00M%K0  D0T  00 0ЧΧ0! D SS:1 -LLMܓ `@P@sEVQ 00M0<0  zT  @` ,0B10s C ^8 K80C#6D 40  ! 0k 0"$K X0"&*4 崒 <  $8 4K<K 0 ɦ3僦LD0S#003 00X0 -8 X0  0g0:0ᥦ0 X303<0Q 0FP-:000$pH`_oVRPU0[ SK L0;PL%V0(0UP!>L0 0P 0C3>0CS0000 00KȀVH S0 KD묠K0UL 0B?o20S V 1S 0S # P 1 41#R*, n UW 0 0 P UlK 0 (P0Y !R01P010U X Q )9  0 1 O'0 Q[0à Q 0X08 0/ X0 `3S 0[S000  0S0Hp P` K l#-0[S* 0S'0 0K,0K KP# K ~p P0p土)ڟ3A0300C00p KKj0000 S0 0Ã0 0$X Pl0K1 UX tB 0 K  P!05/ PD)/P 0v`6 1 0U0 a10Js60U3 32Y/ 6Q?< >)z0Y003030000[1 Q 0  ~& 1  P1H̠l20l20b0C00`00 L0p K1   1  00K00K 0PP  01/P #Z4 0/ z0S   B  (KKXY``VP 0 弞d庞(T03 V 0DAMP Kk3 \3 03 000(՞U U P 3 R>P0KHp0 0KKSp PU0u`000 0000 c3 3030W 0"Q  01/V 060 0PC0P 0 P0TrH01 1Uf0 , K!@ rQHK PK #Z@ zD F00000 0"`0p0@ppL V0 K1/ R0,K1@ 0, K1@P0[ S00#10U0K 1!h20h20[ SX00000I 000 3S 0[S000  0H`PP3 z3K 03}0d00+0 KK&0P0K bxXd;dA\@t=d|bAAA@AA -L M, K@`7 PPp Z( KP,0  JT:U 彝,I K 0 QR,0 S U ᬝ8,%d,P,0@0Sm($P 0't=dA -@P`L  Kh Q-LPp`0@ST`# * 0 `P T  JT 0 bT0 *b -@DPDpL`s  0  @k b -L.  M   K0.    R0-LP@ 0D0 K0hD=D -L M@0 1K -@0ML040  0  ; R0 Ktb A;d 0 S;d 0 S;d 0 T;d// -L0LpD@QD0L`Sp-D0D0Kh bb0@-EP@0 C@@0t CCP@0B@@0 B1@*@*<0@?&!: SR 0%0bb;d -p0LAPD0UP0LP000ct00h0y0@0 o b@|bA -L8" Kh0 -LM0SX@ O5+l0KK "%"' $-#9(3 K;dADId? -L$MP< U `0E0p#Q*LVpLSZEQE(PEN 1@@@TH#p `8 @0 U7 80 040K00<pP 0G?o T20S% @0 p@ TJ30DU014 D0 %D0pPE04000K ~0`P  W (Kb4 0S/(0$00 S; S90/bJd -RL@Mp`A f`1 0 1Y0DpK0 1 00p0!S P |W 0 0P@0< 01@1 00p0  7 P  0 ! B\1pPAJ000p p0:pp0!0gp00Ph0 00V)30x0(#0:00 T Pg$Kb=d?x=dd_>'/A=ddA>dA>d@Id_7[7?4BAd? -LM >0R('N<'0 0 0@  0 `p PP ||JW0@@^U>P0  00 0 P /W K老@AA -LMT1p`L10PP0<<@@0AK劚 1 p#KT0 W5 z X0pCXp(Ko贚*0#K 05$P 3 030 00\CKCK$Pp$X Ko$ ቚ(Kx=dbt=dAd_>h=d;d -L@M`ሐV:$Kd0K!<PpZW@@U@#TEd`KW`Pph!;$@d_> -L. .M   K . -N@L`P@ U4 Kh  -L,M@P000 0h1^0 < <N  P 0K P)0`008P Pp5ApF@0 80S0f0`(K0 ! P@0S 0 0 ` ])P L&3z03 @0< 80j:C80 x=dbd_>A -NL$M@00Kpe`P*080 A33p0P<0 W0000<0 00 s! P80S l&0`0 `   0 e(K3zG03 @0 0Zd_>Ab -P`.<0 N@L  0 Khebd_> 0-<@LP01gP-g!P3#0b -Lp`؀ؐV$Kk8@ 0SP!PU# 0BQ30S 3 B0#33SQ0S"U `FP^P0 It=dA -`pP㰀LU@Aᷘ3S @n#T 0 0pᢘ3S303j"՘Pt=d 0-PH@L000   0R 00000;d 0-L 0@屘0P(j0S :" 奘K"t=d R0-L@P 嘘U 唘 K0h -@LlMp h `0 \0 T(Kp0@@ 0@ H0 h0D0 p0<0 <4 KD<PHK<@\0` S 0\0CAD04`<l0 l  00C0 S00 500$ 0d X0  yd0<0 080 00t0 D0x0 H0S \pX0t\p &l0QH0S 1HK<Y;S` 40xJPPY 0 P 3 Q 3S 40$ HHKm@000PX0p0X0 40 HHKP y #Y44 0/$ 0X0Sh 6@D0h0 bP壗3S  403S303e!ЗP 0S ʗd 40R $PH0Q @40P L "JLK PK 01/  P[ HK40L  J" LKPK 01/P #Ps`2  ` 0/ HKXY /P0 P+P03 Y 4D0DAP HKP3 P03  P2!LJXZ Z 01PK7P:P00.P ,2P 3030 = HP1X0 0 0P 3C003ϖ 0Ɩ3x03p0\0 HKUD$HK P U 嫖d H|bAt=dAEd A -PL4Mp#K0U`sA0,`K0CS00&化&0@ Kp 0  00 $K$ 2xBb 1A -@LMpKP` `  K\ 0p 0 `  0  0P@?o20S0S 0000(K R 00 5UP b0A /R0C 0a000/ P-L KP0T0@Ed -L@PD! 0P 0#6\ R 0C \0C0060@*00T 0P3#\0Q ;d -LPp`@T 0H@0P 0 D B"&0$P 00S 3/000D00D   @0@ -@ppL`>0S !S P˓0S dW000 b 0-PL@P00S q00000h 0- PL@ᜓ00XK0h֓T010/ b -L  vl=d 0-@tPt0 ML 00@@@ @@@XH<0@@0@ @@@0  HK0@Ed/A7A-00\H0^\ ^0^ 0S00Q : Q*000000\ ^\00 -LM<0 P0`S8 @@`80  (KL 80R:)=0#Z00S  8KX8P0S0V00  00000C,K 0 00` 0 0p P 50 KP UV00000 00 0U00 08 @Q0#03R0#S 080< 00` 0 8Kwp P V000 0S00 PU 0S:p80 V  P%W \ Qp!*Q Qp! Q:W Q * Qp!*Q Qp!P S*QX \U:P QP*V SN*V  BS8  S:P` 0 8Kp@ P0P 0S4:0P0 V0 08K0 `0C80 0p( Pq V00 S! 000 V0 0 00C80 P` 08Kp P0S00 SW V0 0 00C80 08Kp P0p < 0S*VPPV00S  R* 0S*V00P -@PLTHP 0 D B00"&00 $00S 3/`@ -@PLM0PL0( KT@1UP!T@!`P(00(0 (Q:s K00 $H 00R0S "Q`pA 0 L`p\* E `Vp`O) -P@L M`UH`0p 000P @0S `V000.HP00pW !D #Q P K4 R @ R 0 0CV <$6SW H110H`W P40S @0S00 80$0S 0 00e@00@0P@0S `080 PP ,d04 R@  B@ 0WHpV 40S @00CS@0 p;d b -@LDM@0 OPL Y1T1 X10 K P `0@@ 0 R:`@0 00CP0 [0` `(KP @ R y` R*0R Hp$0W<0  @0  00IL0 0X0i0iH0 嘐H080 0D0 L H008 R0C)D P<0XP1S b080 <0~<0 Q` 80I @ E0 `p`<1/`@Y: )D X0 T PP Q PT X0PT1T1111T1T FT3S3S \80:C80  PʴQ00SD00DP 0t=d -LM` KP@pP 0P KR 0S400 @ T: 0-@ PL000K0h: 0-@PLDD0D00 -LMH0`S@< T  0$pP C8 04 <0 44 0Q@ hP00S  \<0 * H R  R0 40RT T "$ R44 Q88 Q<< QLL Q@@ QW   0P"QP00SW  U   U    B   Q00S D D H H 0  0 @S0H0QV S 0S004ST0 "$0S4 40R{8 80Rw< <0RsL L0Ro@ @0RkWJ 80"YXa00SBW% 0 00U000U0000C00  0  00S D0D0H0H0000009S00S 3/00S H R;  R 2/e00S  8P 00SV  8PN (K -@L ppP`00DH0PPPLp`PP"XR  $Kk謎ꨁ@>A -pP`@L 0 SA00T ?0@0h@ -LMP`p $E@p0 K@Gd -@L 4Q``D`Kh 0-@ PLh000K0h裎 -` H0L@SP`B   DDH00 $Kh"$0S0SKh/ -L`Pp@T  00000   @0@Kh -L`Pp@T  000P00@0@Kh -L,MP0%4@8 ` E0Pr8) 0 KP 08 0S000  * 0R*00000S-0 p<0圠劽Í5   R  0P0 80K 0 S (K<0 0 jQ<00 R@p84PyX8 0 QP0P00L00P ! 0 #|bb@Ed -LMp( K@`P P$K( 0S0W ;(0S 0S$0SH0SU % 0QP0  0(0 I00P000U X 0`F( `0` 0` P0Q00Q0000C00  0  -SL M`Pp307/ PL0( KUP1X!XP1(@P@ 0S* 0S 0P 0S 00`0(P$@@ @0*,00!p1 000`(P$@ @@ @P0,00,!! 1 00`0(P$@ @@ @P0,00 00000`(P0$@0@ @P0,000`(P 00$@00@ @0P0 p$Kk&2^ADIdfA;dT&2nA!2uAb}AAbAAApbAtbAp -LMKK_K@/$/K 4`S`B```` `a`a cbcb`c`c$`d(`d,`e<`e@`fD`gH`gL`hT`hX`i\`i` j    2/KoKxg/Kc/KB_/KB[/KBW/KBS/KBO/KBK/KBI/KG/KE/KC/KA/K KKKK K K K K K  K Kh `  KX 8! KK K$K(K0l 4d 8\ KK?#KK6K` e?TR 2  0S?#2 0` 0 0 00 0000(K;d b -LxM@|0KP`p` =T0 <Q< < 00 0 0000000K -LMⰁ@P`` K0 0 K\ 吁ph1h![;[+[̀ P.YKW+K^;K0弁KZ! 0T  0C0 00 0 0 0 0K00  0 0 00  0000u(K4`(\ ̠ $A( \ 2(1p3B(108C8@McLcb;d 0-@Ld0/0S // -LMpPK` 0`0@0 0K\0 0P@ 0 0 000 0?oP20SP dQP PPd(K 0-@L d0 00-L8M 000( ,0 0@P'. , $0A 0 ,K0 )2 -LM` 0p00 0PP >0>000C< SJ3 SF:LSj*Q 0C0=P 4D@ YXR * Q'(Q 0  ! 00 @P 00S 0003/:#:S  @(KQ'Z 0 @@ f 0D &6S0S 0 <46R*0  @000 @P 0 d_> b;d0ʠ,ʠ 0C00S>0 0>00 0 0#L\03P Q03S/ -L$M@:#:S0>0>0 T< *4!P#6DpH0 D 0H 0P@0 E0 K}P' 0@0 >D0H D@(K <R*P R:<$`R !L 0  T!QL0T :00000 000Q  <R: JPH0S80  V L0T :V 80S 80SV00!S 0 00D 0=  JP0DD P 0@0 D@ -LTMX 0@T4Q`H0 @ K0(KTŸN@  @NK@ P^K 0p 0C H0 D PS:L 0#3R03:QT00<0 @0 tK0PT0 0 0(0So D0K 080K0<0K0@0K0 04K00C0C0/bpb -L M`0PS@D$0L@09/@` IP T 0\ 0 0@0 `00000a 0Dr$K -L M0PS`@x0D$0Lp@07/X0T @ `  0 0  0 DFK -L4M8 @ 0p 4P `   R@  R H<  X X80L0S (KY 0H0<0SPY ,0K  #0(0 F  P*YD$! 0L @0 LJPt=d -LMP(KK R fjAv`{(K'K00 0{@(KV 00lK@  p0 l     0 p K 'K1/@PU6{ p QL/{l0Kp R.0j{p Kp0`V6K Q Q 0 1   B0P0 B{hz 0  0S0 ! !  !  @'K (KPt=dA"PR0// PR0//0$ R/  !0;dG- `TP HApP& (0!00C0000 0S   0 0S  0 00C03 $00C$0^000000@P (0!00C0000P ( 1  B P ( 1  B U;d(=d -0` L@RPp0S0SP|TV0  R 0 0P`30300040R,`  P 0ꨂ@$00000000 N@81N@$681HV 0CS*6뤀p0WWW0@@N@N@W\0 K(KP< 0 (LJbXId;d)A@IdRAd_>A -,2,",BL M0 00 0y ,y$ p5$ PGPOQ0 S00`0F 0!ࣥ vpbhN  I `! D 偑 00 000000 00 (00 ,  (K+`FP 4 400C 40  \40 c& `Id b(=dt=dp=dA;dB},=dXIdb -LMK  p  K8/ -L,MB0SR0S bpdx0S<0 Lx(K08p D0 0H 020H0 1L0 2@0 804K40 0@01000 0K<0SVڀ1P0 M R   R 8 4"& Z  !   8*&!08 4"&  0 Z  !  8*&!08 )&0!  0P 00S\  40H X000180L 080 80,@`:xT Dq;d(=dp=d bXId0 N0 : ̠(=d -LM`8 <0 @ pwt2tP8  00"600 f1S $t  l?RPQp R _R@ ,Rg (R! R`@TW WJ&40pKp 0 Pp 0 PA H!0T p  p pQ  ҵ ŵI 80 `#(0<0,00S0!  #vwT #W # 8 (K00K0 0PW 8wV R  #p=d b;d(=dAbJd;d$Jd0 0 0 C`2(=d -LMP0@ 8  R00  Q C@ 0p`ss Z T}8T"t t(KU P ( ,"&.p@` p80T<@  100 R0``ss00320<0 U @00S3 03= U  303303x T 00 P0  (,,Ơ03@ @030姱00#  #! !# #T 0< S R s000K,|sspesd@ U`X00X0sU U $10C$1tUp@`]t=d;dh=d -LM0 KN Kd_> - Pp@EVv1 00M `LV0 0 W0 sVs,K` -P儐p儀`Ls0Sh69sr@@@D2sr&+s ),Jdbp=d;dd0Jd -|@L  P  P \00,0LS D0Q< c_GR`P 0@?AD0;d Kc 0HQt0 10 1P @0 101.o,o PU 0 R"0P s0S  @P@Y 0R q0S p$@PD@0S Pr0S "@PBDJd;d@b@|/3 /P000Q000/DJd -@P0`LP d! 0P@   (  4 @P L2 XKhDJd m2/00P/DJd0 0hC40@S/DJd;d 0-x@L pr d(n X4j L@f @Lb 4X^ (dK0hXDJd9AAAIAQAYAaAiA 0-@LP> 3RC40   R h A $A$( 1  B 0303 00 0000@ @@0;d -L MXmT1TqP@T 0 0R410ӵ0ŵ(Kon 0R00 0 3<00 03`' 0(P 0,0! 1 Y @!  ! ! R! !A!0     0 R$  $    p=d b;db(=d -L,M@   \#2\T S`!j3pAFp^P %Vp Q": S00S $6'00 em, (00 R 080 00D0 O@t0P@0 80S 080 Lm$(0, 0R$640 0&f'v#60c<0 0F80 /`T0PD0 80S Pom(K080P40S0PU NW*s@P@!@1w40@D @S0!00 0@@0 0 Y@0P0TW!@@Ot00 @P0100 D0@@0 0 R < I$@@D @@L0  D0H0 CL00X 0@H0S#IN0L P0 3L  HP00 (0  )80P`' P`! `1pF 4 004 S`PUG *H Y*00H 4P Sp10<0 W'<0P0 `GF40`EY`1 `!< <0Pp1F@0 <0  DH 40H 0S40 `P H}lX 0S 0>H 0E@*;dp=dA -D0, 08LR ((,\0(bJdA/0@/(b/-,0,0 QԞ" 0P1(bJd -@,p|QL`T#$ R R&R$*&    0R 1`VV(딈 `F`PV,PXE,E@,p#R@o#^ A  BA  0RP0`V w%`F`PV,PXE,E@Jd(bA -LP`_,@E# P!*   0R `0`VT'!`F`@V,@XD,DPJd(bA -LM01p0PS'@` V '0 @''U00 ,0 V,0 $"0 pp0 `U t0@`(Kp04# 0SX06#,C T,IX,J@;dA(bALAAJdp@-,`\0\P0S  / R$ P :P*Q @p0C?0(bJdp D00P 800S , (01 ///(b(=dJd 0-L@P0 0-L@PD0 0-LPP,  05$ 0Jd 0-LPP,  05$0Jd 0-LPP,  05$0Jd 0-LPP,  05$0Jd,0 ,P 02 /Jd,0 !$/Jd,0 !(/Jd -L`PP, 06$(PJd -,0p`РL0 I W6P@@P  80 #6< @ D H L  S : S *0 0 00 0-jPjjpJd;dt=d p-P0 ML` L0LP0S00? 00=0   =,0V$ Kp(=dJdAA -,`LM0h@(0 P@' 0S2@# 0 0,0㓕$(0K0@0P00 ($KJd p-L M`00PS@ xx[&t00Sl T`\X%* K AhP@H&, 402!P`$@Kp(=d@A;dAAA%AJd -LM< ,K!8 PPv%(K8<0pWi%P10` @0 R00S WH*dp&,Pd18@< 4$0! P W,1pW %,`pGp80c#``80,`W80XF,F080 #*@08@ R< 00C 0,0R$ pp P0<`P&` , L08@<4$H  0`C ` ,%P@HAqA(=dAJd(bA;dA -L,MpP0AK i#K R0 0`EiV*  0@P㤀#KT0(Kh``F,K&f`*h00 00 00 1/0f 0@P#K@P 0-8 ML  000 000 2 KASd -L P00Sd 0 Sd QP-LMP @`pM Q 0 =S 0!  V0 0!ı60!R0 0!ı! RAZ:#Kh#KR 0N 0#Kfh#K!0 ` pZ#` S 8` pa`0(K VP SR -fpLM@V@@Kl0 R0 0S  4\Q P<< 8H  BH /80Ud;dT0 R0/0S  (Q, Q80Ud 0-`@LPU ` S  R   00 `800p <00@8@@H00H0 R 0 P0S  0  Ud;d 0-D0LP00 @ST000 Ud -@0|Q00P0L0C`P0gP'୷P""R,40 qt0S)4 140P "wgL00CL0$ T00CT04>P# `eg000P00P0g`x0``FV`6`8g, (30HCPb `;dh=dUdXd@A,b 0 6Ud -L(0M 0 0  h K$84Ԗ2 -00ML06 0 0h K$84Ԗ2 -LM600 p1!Pa4 P80 @P  0  P(K? 6%:V T[4<0 6 S  !<0 !<06$0 000H S| 08P0f0T  T gX$ 0 040!800R000XP[P \00S0fa0fᦻ (=d bXdb!Ce8]2 -@LL D0RHq`P000L00L00PyfT00T0f| -CMLMT4 1HPPP$  QP1P!0mK `Fp0X4 W0(K@ 0T0C pPH R 0B.1\4 _ \4D$  <4 X@$ 084 P4S 3/T$ PT48@;dUd\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -`@L$0  C00C0 00C 00S0Һ0S   R0 L00CL0000($Kk0S0ȻUdVd -L4M<08P@4;TP%VZep4eW00$00姻(K4(`tPEaY! Y  " ?# "0 ue3eoeT00T0e먀00o h0P0 000$H0 ;@0 4D0 X00K@ ,`K 0&?40K0<0K0` 04(0PL0 #KSR!L00000 0S`xh`9 @K ?80㓪& `FV4`:0 00ɔ00$` `0L00H0000)#K 0 0<00 t Rp0!"P0S  |' 0 0 0H000A $K ?$KH0H0H0 vh=d%@AVd0@1AUd2 p-8Q@01LMAH@ da1 P 2!P  @Pi000@ @@@@!|2Pt `0 0 0 `@@\0 `@0@0 yKpUd;dh=dXd@@@IAmAAAAAAȓpWd pWdS Q N / -LCMP0 @S`Q P7H00(K8X,埓00CS Ԝ2<22<2(2<22603/P ?60`B>  ~000 $PP0 S 0X T ᫩P#<6pC:P P0SE?K% ӂP00CSkx2l222222K`P0S|%   0T 0 1 0 1 " CK`P Ppt0SPp0P4 p |4Lu`@c`PP  cU P@04p0t0PS 0p0! $ Hgc5`P cH]P|yP Zck0! 7P IK \34 1 XtY Y$ P0P 10X 1"> 1"! PP c]XcH2PI?Kp ?4; fjt0SFPPYP 010X!820` @0H 4A#"#04>0C6Y 01 J1SI >K!X.PPt0S( T!0S"   h 0h!h!2P XX51K" PPp`0`00 @x0S0D01,`(0b0000x0L L P PbxbOP\bP0@bPP;dpWd,b6cldXdAAAh=dAA|dA%AJAjAUd Aؕ2AN@A -Lp)嵑IbPUb,Ko@T P 0&$ 4`yP ` %bZ `8 <0R0<0# @ H00CH0XV H8@ApWdh=dUd;BA;d -L MHpH0PSK0 SQ? 00a `V0S00S4 @T ` 0)  0 0S#0p 8<00 Q<00<08t0800<00@800 00 0T00T0a(0 (K8@ a;dh=dUd -PPLL@adX<0a 0EP@T@@ah=d;d,b -`@@LPau( X00CX0$0$Khah=d;d p-L`PLoa]@( F0e 0 0C 00TATKhah=d;d00 D 0-LM`@q \0P0\0 @0 6K2PP(=aX00CX0zaK0;dh=d -LM@4q`DP(a@ !N@@( @0 DЂ QPpp\p#p2W Sa p$K0Όƌ R( Ea*p0 0p0 D(KpP(00D@#F@/ap B,(00C@#FD@-D0S h06CSa@0!Ơ0P8 @`p&&'6*U\/R/>0 0 k  -LM#Kt0`@SP  @ 060p#K  #Kp` P(Ko"  -`pLMP  0A@P0 (K# 00 0 0@P ` ]`# 0 #  ᔧ 3030@YP0#10#0 S#AA -LM#KX Pp, J APXpJ04S Q 0p(KP#K 8 P8 P#K*R0H#K0 @R X#K*0#Kp WH#K kP P -p`LM@0 p`_$V    W  R 0 00  0_ Kk_ -@L`p_dKh_H/H  /H   @o/ 0-P00L@T0P @K0C`0 ` p` *4 @ (K -LM@p`P0 0K ,P ( d0 ` \ K p-LkM@P1 `0@0nK^KPPD0n/K0!^?KF? K1"MKPP1n/K%0M?KKp8A,A -LAMP : 04a  x!  |! !1 1 0  @DqHL@T\  y K 0 p 弐 Dtu} Kqx0|0 \0x0x0 2 t 0$0p0 #]l h d ` \ X 0 PKT0 i0#00KGK1@KQ KK4p@P20T#0GK0DGK[@P# \pW@ȡ ̡ pС ԡ ᰡ ᴡ ḡ ἡ8A 0U8qGK9@P \ 1T w4q圷` KT2T"K0 L2 H"0 D2V@"ż0 09K0 4040Ӭ0 \0ð0 0 ŰjKѾIKѼIKѬ@ @K@ @ 9K{40 K_"@PF1V7ugb1 1 尐f0    p40AK C/Kx  @P0S @ 1  1@ @@  0 ,"@PQ% W 8 ( K4(0 K` "@P P01 (K0 S1 0"PPU U0SP  !P @@Mc,AELF4 ((l20000/xWd000/-AM 8R#8 'R R, R 08P#80$Q  44 0C8#8SAߍ xWd0A- '@pP` $ '\  \ \#Q Q@0 Q Q@0 pRS*  QQ0Q0xWd~ -LM`0s00pQ 0Aa 0@\:#: (K0@ΠQP@_P@@A0 040 0 S2:00N@@- R 00 pP0 B 40.  0 0R @p B pP@@X 400T 000 pP00 p22P2P Q /7H7b -LxM`KPx d@TpC 00 0$p0 00 00 00 00 00 :0 0|0 0x0 0t0 0l0 0h0 }>d0 0  0`0 ` 1\0 0X T0 0 0P0 P 0$@KL0  0D0 41H H24pK@0 00$90p00TpG 41p000 @=uP @@ 5uP0@@@$K p-L M@P`5P KphrKp  0-LL@P 0S 1(S3 S2S#00>A -LIM0 @3S `PP1S S P2S PP22$1 +$1 0 0P0,0(04000 0"R01 rQ50'0CSPQx7 <0 0 0PP?H00CPh0PU ,0K⠠#0 15/PP)̠X0Pp q 0q B0!"R!" UP10Q U!3L0Q*CPEP10 P1Sm8$@ P " 0UH001 00 0Sv S001  2 S0S,1 ` 00s0~p~p0p401TSG pp1 W4!PP+pp0$p0tQ1"zPP1K"PP`0(0 $ 0;0PP40 0 00`. 0. D0 (0141D0 >0#60KШ b -L@X 00 X00 `p``0cXp  [pb -b 0`pb 0L@RP:U@ P f00 0000b -tL@$`pd0SP`0 S0000% P Pb -LM@`T2  01 @-p0 @& P4"$@PL0L00L00 xq~ 0 p0 D@P 003/ K@ -L M04a2@00 0000 qpPP0 p  ጔU 0 00 .  0D>pK 0-LMP@P 04*"*0C000C0 X0  00. 0. DvPK0hK0 -L(M0K0200 0 0 P0S K -LMT0p $#00<0<041@0CUT@@@41<@H<`@p0FPB 80`F` R 0C 0Es 0 00 000P0F0P 000PP0 KbP2 -LM0@`0 0 `i,P 0 KS`P p0m/KdpP U00p0K !0aldldldldedA -LM4Q4C0c (?Tp0S T2 KP2,K 0!2 00 0*D`P Q0  KHD0 p 0h"A \<T L7H5KfPP,K<PJPZ K3P 0[/S[,0KP0@K0E-00KQ s00K0 K0KnPRP}0 T p 0  00PnP80 0C /P 0 0 婘 P0@P  KP 帠 nP  KK 600  P_oTRPU`yT0`0`rhc(K@McxXdA@wA A@XcAA$@AAx.BA A:AEAVAA%AiA -X`P𝤀0 !`!800 (  , ! b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc 0-,0L @R 0K0hldld -L\0P0 `!d 0UF ?,d 0T@!Jd 0-L`M00@ 0 Q00hKP00hKhK@`T#ʸ @Q hKW 4/0 0hK&#:hK4/0hK0&#: hK\4/K0@DxXd7b@Ag@AAk@J}AxbKA*7k@@AJdA;dA 0-'@`PTML,0?0? 000P(`$@ @@@ @pV0',0t?0h? 000P(`$@ @@@ @A0',0(? 0? 000P(`$@@@@ @,'0!>0 <,0 00P(`$@ @@ @ 0,0> 0>0|>0P(`0$@0 @@@ @ 0 ,,0<> 00> 00P0(`$@ @@@ @,,=͟ 00 0P(`$@ @@@ @`ץ0,00.!= 0 <0P0(`0$@ @@ @¥0,0\=0 <0 00P(`$@ @@ @᭥0,0 = 0 <00P0(`$@ @`@@ @ᙥ0,0< 0 <00P0(`$@ @@@@ @ᅥx<, 0l<$0< 000P(`@@@ @oS0,00$0< 0< 000P(`@@@ @X0,0;0 <0 00P(`$@ @@ @C0T˟,0t;00 0P(`$@ @@@ @-0',0(; 0; 0;00P0(`$@@@ @0,0:0: 000P(`$@ @@@ @ 0,0: 0 <00P0(`$@ @`@@ @R D:, 0 00P(`$@ @@@@ @`٤R ʟ90, $ 00 4P(`@@@ @¤R hʟ0, 0 09$00 4P(`@@@ @ᩤR ʟ0$0 0(9, 00 4P(`@@@ @ᑤ%0,08 0 <00P0(`$@ @`@@ @}&0+,00!8 0 <00P0(`$@ @@ @h(0,0H8 0 <00P0(`$@ @`@@ @T)0,07 0 <00P0(`$@ @`@@ @@*0,07 0 <00P0(`$@ @`@@ @,+0,0d7 0 <00P0(`$@ @`@@ @,0 ,00! 7 0 <00P0(`$@ @@ @-0,0;'$06 06 0600P0(`@@ @.0',0p6 0d6 000P(`$@@@@ @֣10+,00!6 0 <00P0(`$@ @@ @20,05 05 000P(`$@@@@ @ᬣ30,050x5 000P(`$@ @@@ @ᖣ60,005$0$5 000P(` @@@ @70,0404 000P(`$@ @@@ @j90(,00!4 0 <00P0(`$@ @@ @U<0,008  p$!,4 00P0(`$@ @@ @?>0,03 08000P0(`$@ @`@@ @+?0,03 08000P0(`$@ @@@@ @<@ @@ 0,0X3 08000P0(`$@ @`@@ @@0,0 3 030<0P0(`0$@ @@@ @`A0,02 020800P(`0'>$@0 @0@@ @֢B0,00"!\2 0800P(`0$@0 @@ @C0,00,"! 2 0800P(`0$@0 @@ @ᬢD0,00!!1 0800P(`0$@0 @@ @ᗢE0,00!!l1 0800P(`0$@0 @@ @ႢF0,000!!1 080` 3>A2HAdbPAYA2`Ap:;BgAX5qAAAA|XdAXdAAApb`3Al 3ABBAAAAAAAAA&A8Ab3GApbSA^Ap@eA83jAT2XB3(BrAzAAAA 3A3AAAAAA A<c AH2.A` 3=A3EAKATAXd 2OAb2AZA`AAfAb@tAj@A2A0P(`0$@0 @@ @ G0,00 !0 0800P(`0$@0 @@ @H0,00 000800P(`0'>$@0@0@@ @J0,0D1 0L10800P(`0<$@0 @0@@ @ʡK0,0101 0<00P0(`$@ @@@ @ᴡO0,01 010<0P0(`0$@ @@@ @១0,0<0 0@00H20P(`0<$@0 @00K@ @`ቡ0(0<00@0,P$@02 @@0<000K @`t0(00$02ܢ0 K 0<00@0,P03 @0800'>00Y0(0;$0 0 0<00 K0@0,P @0`30l30'>00A0(0; 0 0<00 K0@0,P$@03 @0800'>00)0(0<0A 0@00 K04,P$@080 @0'>000(0<00 K0@00X4,P$@080 0'> @000,04 0800>0P0(`0$@ @`@@ @0,04 0<00@00P(`05$@@0< @00Ϡ0,085 0<00@00P(`0\5$@@0< @00Ḡ0,0<00P(`0@0$@ @05 @ 050800'>00ᠠ(K 0-L8M! 1@P`000 00`,P(P$@ @ @pၠ 0,00 $00!0 0000000`(P0 @0 @i0 ,00!T00`(P00$@0 @ @0 T$KA`2 3ApA -LM$Q (R`p@0 R0 0R0 R00 0K` <0 KT 0 0@00 0 0˘?oP20S R 08R2,2242<270$K887|Xd -LMp0`0 @#&0 9 !|0KP ` 0 KL 0 0 000000ᄘK6c -LMpP`K0` @0 0K\0 0 0 0`@000 0`?oP20S  (Kld -LMpP`K` 0@0 0K\0 0`@ 0 0 000 05?oP20S R (Klb/u -LM@KP`p ` y0S S 0 0 0CS0#610 0KT0 0@ 0 0000000$K$0 00 B":&0 0KJd;d -LM@0p0PS` 0"(K|0K` 6 0R RK Kl!00L < 0 0 000000ḗKvc -@LMPpK` ` K\ 0 0   0p  0 ` ᔗ0P?o20S 00 = P00  (K -LMA 0 `PpK` ο+0\P ɿ0 p 0 0  0 0Y0Pp?o20S00  pPp0Sp +\0塿 (K@d -LM@ 0 `_PpK` ᅿ+0\P 倿 0p 0  0  0Pp?o2pW0S +\0a `(K@d -L|MPK@`` pK0X0 X& @!1D0 DD T ھX 0  0 000P 0000ÖD@T KX00?@0@D0 Kc b -L|M`K@P` p1X X4 @/ U(R( L L0 LL \ 卾X ʬ@ ؀  0 ^ 0 0 000` 0000nL@\l(KX00?@(0@L0 KcXb -LM@?P` ߥpK ` ᧾ K\  0p 0   0  50P?o20S PR @ `'RP  (Kb|b NMb 0-PL@I0S0,J -1LP1@4]p `4q 0V 0P0 !(0P:0P1 00$0H剠$0$$$僠$0$P0(00,0(0S0 04000$ t0 l?S  Q Rp 0 S080t0900S  @;V0|H00L0 00P00T0<0 吁X \0`00d0x0h0TQl l$KkN b8@@@B -pLM`@TPK ` 0KT0 0P@ 0 0 000 0t?oP20ST0P$K -LM@apK  ` P嶽 K\ 0p  0 P 0 E0P?o20S&00 0 P 0R Km<0T @)KK Q 0)K$000 K4A(Kpbɚ;6e -LMpP`K` 0@0 c0K\0 0`@ 0 0 000 0?oP20S`@0S`X0K I0PS Ő00`PPŭ뿦(Khbb -LMR`p@PK A?K` 0@ 0 0 000 0P 嬔?oP20S$K -LxMP@K`p` T ¸0D 0 0@ 00000 0~$K0,0$@ @a@ @Pԗ 0(00 00,$@ @a@ @P× 0(0l0,$@0 @a@ @P0 Თ$KDAAIAXA"A3(A^ATBMAxBQAAXAT, #60@P R  P 0 / 0C -L3Q0@` P *a"WV:`Vp0S S0 0#d 0㚶QP*0x0 0`pL0 0#d 0〶QP:00XdbaAuA 0-P@LP t0S  z00P 00000Xd -Ls@ `PUtPdsq10t0SXxVs<0800( rAXdXdAb|bA0000 rXd -0ML00`p =PP9 Ku@PP00 1@ @ 0 p Ku@P 6Kt0S  @""K@P  )K? @RKPS"KIK@PP rZ0S@|r0000@P F0S00P00 0\0@P XdXdA3 -LMRp0SP4A@ lK Tr0SP*f@0  K K@0lKv B0 K0Kd CK<0K|K> C%Ky<`>C'K R00t'KAQt  R0'K=9 =t0 t|s(KK K 0'Ktt Q 0'K=9A =Ct0 P1| @1t<K ($00,3K@0<FKyL |`H pBl0+ 200S& .#KB?0 40K0000000 00 @0l K.PP  L~ K@0 K0 r(K 0Xd?B|bxb@McAXd 0-P00L@T0P @b -@LMp` PUTV@(K 0 00 000 0P @ صX@e[PP@ -XL^ :S\! Khl\  p-L MD0`P K@P` 00KpXd 0-@ 0L0Xd 0 Xd0 Xd@ @ R D0\ DSR/// -LM 0@  D H  L  P  T QR #X i KX R #D00P0 00} -L MD 0`R@ P 0R0X RPp ( K( )P(0S P0S K 0 D  P  X R # \!u00@00H00L0 0T0000/01/ b -pPL`@V@P P4pP pV 000V 0 `@ 0S 0 00 P000 @  fpXdb 0-@PMLo0@0@ @@@0     t d T D $4|(K0XdATbAAAA4AMAfA~AP/H 0SQ e0 RQ00b -LP`Q@loPPToF@0`0 00 @ 00000PoXd 0-@PL0to 0S 0 0S0   L00C0oK0h0 R R  00Xd -qLM: K P P H -LM0  KXd -dpL P`@`@PDPHPLPPPTPXP0 Xd 0-L@ᾭ0P00P  K0hXd 0-P@@0L@ @0D0D0H0H0L0L0P0P0T0T0X0X0\\0 K0h 0-LP@0 0-0L@S P@0 0-@PL L?0^0000 ?0 0K0hm 0i -0ML0000  C KXd -LM0  2 KXd -LM0  ! KXd -pPML`L41 0@@0@0D0D0H0H0L0L0P0P0T0T00``4!0pP  LK -LM0   KXd -LM0  KXd -LM0  $ KXd -0ML0000  $ KXd -0ML 00 $ KXd 0-LM00 0 $ KXd 1000/807/ -LM\@0 0(0P @ tP@KXd 0- @L ;>0000Xd 0-404@LQ0S00 1>0P00 bXd00CS0/0e>Xd -L>Xd0/Xd -LM0p0 `0 0P0@K0 |00  0 R  ` y0KT0 0@ 0 0000000 KxbXdtb|b -L  r;'&;#0=cKA@3 -LEMlt Pm4ATdD; ;0 @4q  &*?SR: D;B;PX 41 }(K0`0  30SS +;);P@`0p001 :UP`0S P00;U: ;83;%S. n BR)B3 C3B3 C3 C3 C3B3B3"?0JJ`PZPx0"2"J00008<0J> C "/0?P/2`P 8 (! ` RP (  P :2:UV "FQ. 0P J/K01 ΪPPn(` RP(PWPU|010a`P P\ 0a 0 0 1 n- lCKsPP 4L0(1 /(t0S P( (UP: K}P0SP3UKL0 *K`0  00S 000 000 000  K(q/0EK$ 00(1 1 0 ,1q IK 0 3/P@d@McXdbJ}A@AB@bbb -L,M@P!"K0pQ 00  0"Kp 0 !`P 0W4!D0x</`0  $ KEATBA/\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc 0-@L40040K0h -pL40Q040U 40`蠟a90@T9,Kof 9 S9 Y Y," 9(AP U 4  }9{94  4 ,KoP ) b@Mc@Lc 0-<@L 09*'K0hKcKc -@QL @ 0!1 !0 N 0S0 0Af$`P0T100x2- b&Ɩ0 !1000000KcAXb b/0 0S/Kc b 0-LMPQ@ 4K040 4 $ $0Rl0Sd0 @ L U D 00080 "40  00CtG3 bG3KcYc p-PL M@`t8|1U3 37US `1 03/AH1U@ 3C7CU( P{10S&P" 4000040000(00,000 0L1$0P000 0 PP00P:P\m8KpeP iP@0S PU00 000Kcc, bcXb bKc --LM0  0 KYd/Yd-//01, / b0 600/ -PL@n@@}T Kh7 0- L jA -@L/  7011>101?1?11` P@ V@@ 0-@PPL7@0<0C@00S  0 7K0h7@Kc@-!2 !@!$!!!r!E0!311S -A`LP 0-L{T0p@-!2 A!R!!r`!U "!P "!00\p!AA 2S^ 20\00C0CSQ Q 1p0 0-@P@ L47 @0 S:K7ppY00@00@TPS0 P6001E170@Kcdb%ADAKc bQ- 2  a>Q 0 "Rq0 o`0 -pp0L@T`0S4Pm60 P P$p0P6@Mc -QLM 0 |  s (KQ0pS000W0 00 0?S0HS0 0 0H?oR20S0H?or20SX[63 V63xWP00 01x0#0 U `0S6t0S3 0Sx0 R, <60 ` s6 V00 3fP 2g64@=0 610 00V :Y626eP010S @T Xt"$ Qx W  Q Rd 0 00 5,"x0!0 4Jx K Y   @ Y ( 0 0 0 4     | Yx 0t  p KY d  ` ( R Yp\ X KtYL x| H D  @  8` < 4 00 550 K垁5Y000 00C0 X0 0$000Cs `gdPX \@00S00005 50S 0*0ld@McMc$b b -LlMP314qIXP03@03?0 (K@TΆU2 0pKp0 0pP ?P 0Dx0 752p352PU `0SPt0SM '5000 0` ]5V=00 eP6 $2Q54@=0 51|0 |00S|010S @T  400S 1$ 0R 05`x0?S0G 0'5 $5d14dZ>P4114H @ lK0KS  d `  \  X  T  P S<0L $ H ( D , @ 0 < 4 8 8 00 4 4@0 lK姀Px0@p@0Cx0 h00$0T@00S0000$0pG44pL b@Kcld@McMc$b -@Q8ML r4x1@ta0p1pq` 0@@@0 @kHQH1 0<1@@ 001@0:[1@0 1@@ 01 00L0 ,00`pl!P0 000($@ @ @p`ᡇM0 ,00!t00(0h0$@ @0 @0 ፇ$K@KcN3DA Q3TbKcM3N3HAM3TN3OAYdW3R3XA -@4`L]41 R?4@@AT64@T `300000*4 0-@L MP3000CS00 4PK04 0  (0S  0"K"K 0 0,0K + PU 03/P0 :Kc -L,M1 1 r41]A3`VΎ3 (K0001S@ ⬡P  ᴎ3 0S  0$03/y3 01! Ἆ`0 (0S 0@$K#K0@ 3@00 D0K [33lH H  b -|0L1` 2!1AS 0SKh0C0EPQ EhUUPP b 0-p0LP1 2!Q@AT 1S000 $ @T0 b 0-L@PP (0S 00t0S 00 -L`P@P (0S &00 -LM K K -L$MP4@ D 2140 @0p,10Wp!40`V010!80 100 1<0 8002@0 00@ < S 2H0 pP' H0 UpP 80RS40a R`01 SD0Q`P2(KV `#`32dbKc -LM04@40 00 1P1U2Ӆ 1D0 |000280 0Ò02`bYp<0 4 K0K=@0 E2넡0U @2Y0m(K0 ᱦD  B BLUڜ1S Y 4圦4 !h8<00 ᑦ800!h,Vڌ:401001q@?2 -@pP`L1000000240P11@ -x0p@`!L4Q  P 1 2!001 ZU b -UPLMU@`PCh1!00 r10S>L1 <0  1"1 40 280 4 108 ,11 R40  140  &;00d 0hl``00 ` 14~X <0 (K0014 1?0P  b1  x bKc^A -4@p1 P1 mL K11U  0KhKc 0-`!L4q `PP 0 }@P  PU1bP p` 0 ` 1 RH10 ,00 @ bKc 0-@L@ 00 0-@L0@K0h 0-@PL 40 0@010 Kc01 240gޞ b gڞ -LMH2 1414p420@1=00 0똁1XPńaՈ0PcU/  `P n I  ⸤ɒ0âZʂ?1?1 P11111040 080 U0!0(KSPb/c !厤 !劤40Z pW (Q1SQP< T00 < 0 0U!l0 80p0 02"!!!r!E031 bKc -L M11 B41`000 2g?PZ`dpV/^U 8 /Q020?Sڌ9P !-011QP?QQ  ?10(KokPU P  R00 (Q   V Q `  (K bKc -LP@`p P @ 0t1 211 t  PPR @0 @O0 @P b -0LQ4a4@1Sھ@V4@ B1SPaQ`1S𨝸0S  R R    P b 0-QLp@T@dPT``T/W:PPP/UP@T 0d14c:Pvt@Mc b 2R  !/0Q`/wt@ -LxMPPp`@ x K@t@ d@p ` /U :P  K\gO/Ke:P 0 Kzg@Mc 0-L`@ T"+ 44  00(  01040 bQ-//-//-/-/-/-/-/D / 0"/// 00- @Lۢ 0@ * 0 -@p8PLQዡP@(b -PH0Lp@W``Q qP P@Yd -`@(PLx.$@$@.Yd 0-@LDi.@ 0S00  R  K0h.0Yd(b 0-@4PLO. 0 0 00 @ .0Yd(b 0-P(@L;."0PPw.0Yd -@LPT D0`00pH0$.00Pa.@ -D0QL`P@ .@ ?R"0``U F. -@D0LP`-0S00  R  Kh-.0 0-@PLP- 00 0.P@Øኘ(K0hb - @0 Sa 0'C!a0 '1XLPS 徛 P:x (pP M``- 0 0 0Pp-0 S|bMbbw3 -@PL`-80p080080p04 00@@0@@0@0$~Kh- -@Ltk-" 0L @D Q0b 0'! !31SPKh-Yd|bMb -RL@P`H0 03/H 0 R!!0#4#01! 01 R&p+-80$ @00C@0 0R 00 80080[- Y-H00S L=XKh* 0S  A- -LM@`0q, 0  7PP--`Kt0S ,"-000 `P - `7PP 0DP    @ : 0(  ,`$ 0010 0A,@Mc b -L MpP,K(Kr`P( ,0   ( D @ ,l47M`,0(@@D%+ 1 2 0M1( ,4 K@B b -APL @`t,@pW0P\, b  "F ")GP 08!/,0Q 00P03 0#@2(bYd -L Mp4 `X\P[P 0S[XM(K0Sr Y[X> 0P00  ,1 1 R!Y @ @ 04 S 0R @T0 T00 D000400 0LH0 0<00@00! @H00SJ1S> @0!#4# 11  P 003/P; u000 0[T X00S f +렑Y 0#$# ! AT0@   S 4R Q @ @0  11 0R!ź@P♙0 H0 03/P 0 40t+80080+! pg+8008080 R08004 00@@0@@0@0$ U+ + 0<00@0000T   @u Yd  -@L`G0PT 0T @ZP ,oZ0*J@+lZ@0,J@P<dZHPZP@ 00Zk Yd Q-L`@ 0PU`  0-80L@0DP *01T001  T  K0h+0 -L M<0 PPY@p` D R d0("C;004(00,0*80$080 0P$P90 0*$K*Y< 0@0 08 :0<0 0( 0 40 00D ,0 *DK(pl*W$00$0$P$P* -` @PL}P0U M* -@0(@P@1L b}>*1S1S@w*/*4DM1 Q @@10S b 0-0@L tY * K0hYdЁ3A -L MPp` 0QS xQ \Y@P@QP HY(K0 s  YQ' SPS0PPP E 0S  00 =00 PP0  5) 0T 0IC00  V00]YYdYd 0-@PL 0S XP |GY0@P\?Y0PU @8Y0 PP  P*Y0Yd0S 0H0/@@ -LoM  ! P"pP (0S  2 0S 0 mK 3/P&m?K 00帑 1 U#Y10S1 l5P1 21 0Sw iOKeKpB1  (KU`1`#`@1K/K4/PKOK21 0:0P0@ 0S 9 000 0 :/P00C01 @T1PE01 @PaOKX 0`L1 (01 p0A 1 @0S,z@(W p @1 KK4/!00C!0 4@P 0S eKiKPt@ #T0|1 0!x1 0 _?K0(1=1 (}(K?K!R @8 +@  B@  Q   8  8"  21  (H  2/ T(8 1 Q! 8 !T|!x1R 00x1|! 0!SP 0S eKiK9PHڸr(o@ !  p80; 080^( ((W@1P(N(p1 KK @4/p@('101 K?K! R!   T Ru |!x1R 00x1|! )('(-  $#080 #00 0080 0 00@@0@@0@0 b -LM,0 00000 00b KP@ -`@LTH0 0P3/P @ -L0L1 R1Ma' PKh' A b0 :A 0-@LqT0 0T0` 01 " @d lP pP D宑B 0HK0h bYd@d 0-PL@I'0S0' 0'9Yd0 MYd -LMp`@圠8 4 K8P9/PDPWe 4\ 00K  FP ?P(K0S 0A03/00`@0@`ld -LlMP+@00T D0 @ l0 hP < lKMPPjX` `tQ"PP}"$#PPw`0(0r$ 0;0"PPhp0K02 0000P P 0 P pp B *L D!DP @1 R ("׿ P  h ! 2/PPD0P S%*L S":,0S!044 @SR(KlP  l pP  p t T Wp p p PᚿPbYdN/ -L,MxqP `X@00K+8p 2EPPC0/S V-(K5E00 0 S0 ?P#/* b4 40, KC"/C418< @ pU00<00< 嗇UXP 4{pG 0VPC00pGp80 z@d -L4MH0 0p@4a嘄T @ D0 `0 0L0 HU80K0 0T~PP@4 D"8 D1H000 00PdPxP P0 ڙ0$0`0 C5<0T0lPpPhPtP˙U PP"T0@4 XQ \PTPQhX\T00T0@0S T00K@0@000 2 040KBPPsX10 \Q0X1H0S 2 0H40K 0P /P\10 0\140h @000C\0X1T1 $  BP! 0@ 0LR}:@0(K00@0 p00  0PP 4@0'QPF#P4@ @j iZ0S Yf40 040 5X1P0X1z .PPPX\&T00T0PT0 0T0`E @"  )@2  lP pP TD.Ž`0 H[LT E/oT0D"0S RD0 P PPYd@dZdld|25|25b00S P 3/b -LM@0 `p,0 0h (K(0  0010 P40 h?P K4K`?P00K'4CP0 40P040 (0@ 0CS(0 ,KH?P@`Vp Z,K>?Pp4K9?P00K'4CP0 40@0P40 -PLM& @Q4@ aS  D$ 0 @@90 K4K`1 010;0 @0<0`!"P`pD(@T BW,V/AU1@P 4000 S&(K 00S S S ``pp@PPtt} 01p@ 01`@ 00P!0 R Yd\bbbAAb@J}A -PQLp" 6S0@(Q!`ȀVcSP `V `V ^hrSP R(0 ( r# 0(0`0S(0(Zdb b -@QLp+ RP`U P(`U!?S@v#( r,0S#P0S `P, P#X$S@u"(P 0QS   nPZd@Mcb@ -@`PpLU 0S  V KhQ 0SP 0-L@ @P0[^#`P dP 01bK0h, -LMP4Ap 0 Rʜ(~#`$K   `Pᢒ00@0p00 0 P @0ȟ'YXጒLclb -L0h0pp000K03 `00k000q'00p%W 0p00r$00r#0000P  "000p 200?"W0D Lr001!20 0S l0l00l000S0  0@00\0h0>S |0|0S|0|  0|@01 R @@0^m$1uD03/ !<Jv{0g0000t0(0O00! !! [G |A!z dQbQ@08 T h0  !h0>S !(KkD@%0000pW`q {!8  Z 7Q85Q @ !DAbAAD3@McMcZd -L4M08 p10K4AJ`P`|PU @0〠p2 h @:PP0S ]U @` X !S @`OP10[SR80)ސR|V 0?TD @00 P00 :PPTl1 <0 Y`@ 0V*:<0 ~ `V 00 ` :PP0P001 K0K 00800PPQ  0K;PP(K@0 0S 00K+?PP00 ?`X <0 :lv@dbLc@dL3 0-x0L@S0d3/0x0d00 -L0#6000040>0#60@0>0#6000800<004q P  姹 0 1p0X # 3W R94 叾" Y xW5/d ep H0p̀@0 H4EX1@h 41\1<1,0K#p 7/pP L!<T0A   01 h003/DINT0S8NDN 4 H{$H7D@2  lP pP P0S  opW^kL  <NL <l]<D0 堗(0$D 0Lp@07/,pK'003/3 0000 0 DɕpP 003/<01@01S  h04q 00S l0S8 M80l  8 ?N0pl0P $1S 8 R h S 2/ f00P1 h0 000S 3/h0 0$1h ,!D03/\10S _NT0SL N0Bh P0% " p 9 W3d03 ,pK000 帐'' 8p R0(0t000C0Y WU1f<0 S LRDXH0 Hp(K<ld@McZdbAZd@dYdb@Qc 0-LZM]OK@PP0 ;K0 -LM00 KL3 -L <0 0000 t s0 0C0( j hDc 0 1111O0 t0U0S POP1S 00 oJᣃ486z080H/N?(尀$180S 3/7=W~p0  l!l0 00l 0 l  0M20S3 Y  40Z00 0 S  >S  YX X A%Y ij &ხbC)01S h0Z(1S,!,!(!,1 0S   2 R @@00ㄠt00000S 0S  ( 00S0   0@0`0 \0S K  K R0<0 p;X  1,2 Px0P &p H1(p5H1`0 tp0C000000UIN`Yc0E TAb 1o0P ! iPm 0S Q h 刐  h #+h  Q Q ? p T J 5 1-0S:lXdA@Mc@QcdNcMc/A -4QL@ `d0  < 6 -LM0 0pS @ ` ᱍV ᫍ780S r 6X14Q WW v2 p0 0 00 0S 0`@0 0Kp Pu Z$0  \00C?o2S Ph00 0S Ywh0 W5$P \ kh \00S000t R R  0 Rd  !d  00C0V000B 0t R Rh       B V /  h0 000@oᴐYP㨐 000 ut0S 0U ` @0KP 㨠Z4Y 0S00S)PM 30 0 0 (K3,K0x0*"P 3,K0x0*P a t0S000 t0S000 0U`0 =P 0U`0 0P h0` " 0V mh0 P3;h0@ T2@\0PS K KP02 ᎊ@< 0P00CP0< T00T0<:<X:<<X:0S X <ᯌX <0ੌ00(20t00S   00C00S  ( x# $ R 0@ 㿇@/;<O=\Z P %pu $UG #1 B/o0"S R0 400 x0_0t Rd0 C;00("4 0S 0 @Mc bMcNcXd 0-LM@0s ScT0P0K` ,0 TP X KK0 0-L`MP0 @p0 0pKtKSl0Kp0S0 Q  tKO2 00P0S X lKE2K0 0-LRM@0PS 0K0 0RQ/K 0S/KR?KL1000P0S  RK#200P0S K200P0S QK2K0 -h0PL;U@`h0P 0P *P m ) 'h05h0 0PKhZ -4ALPh0  t` h0  J:;P00S Kh0h0  000K0 08  000@00?0 00""$140S  3/420 0S l0l00l000S0  @匀<0#\0h0   R#0 00S s|0|0S|0|  0|@0@3 R @@0;a$1uD03/ 3   R      20S VP12101S b01S xv tp0  o<J$o 0`? 080 `80 SNd0M 0 0t 0000( 0Sx0 000 !h0   R!0 00S 4h \100X }N01&$An%  @ 54Qt87@0l01M000t0(0LC00C1Sh 00Z 0 AN<0+LclbxbZdGAxBmAfAAAXd3@McMc;dld 0-LM 000 K 0-LM 000 K 0-LM 000 K -LM0  , R      ?R0 0000 K 0-PL@0S0 -pAp1LQ嵷P@nm`1<<S81ʀ !` ``&!4  4 !`!`00, !  !0(0,22,2CHCP K\40'000/ 0-@Lj 0d!0 0-$0L@ 6 P0$0X .P(  BR3D3`3|333D3T38$0($ X8$0 PL10L1/L14!0CSL1/$) 0-P4AL  K0h -@L14QL0CL1$`L1S 1( R02g// -LQP8 -LM30 q40 4Ql```X  00 0C0(KPATv@ K0 0 MP1S-PA EX. aD$!0L@0 :/2 00 D0 IPP d`` \6PAPU 0RL `0SQPXP࡟003/*P0 01 000000P )X003/ `}  0*HP   0*嬆X`i 0000@ :0<0ށ00S0 PP0P00! Q0S c /o b2#100C0P2 1  00 0 $20$24 0 % b#b# -41Ll  00@PQ` 0`Fq 0a"000`f`001S 00S R0 0 00S0 @@0@0Kh -LM24Q@U` 0S 0<|V> 0#K#`p #0##K!#K0n ..`pn0 <`00r/0 $ CP00P0 T00T081S88AS 9 d0 < v (1S,!,!,1(! ,2 Px0P e ! H1`3$05ᥴh0T(0PE_0$0C00S   D QWJ}TP!ID ` L10L1GP@@!0b0?o SD!0b0?o S `&$04$08aV 3{ b@McA - 0L@04QS Ka$p$0F7S uDP1 $0 H 00C00(0 R$0 $$0  0 000$00$01F -L M`p4A40 P00 $00Dd0  PPU P;@00  O P!RD1SM U' H140"W R@!R@( R D!@! 00 B SP! |  % (K@!R 8Q40S  #W  $ B D!d0  *0 0C S  eP 8!R PQ@Q@ -0pL14a PQ@T0S 0(D崂 0P1 0*如X@ bb01 / b|P -p PL@2P3: p@#@P5PP ' qPPt0` @TP.K0  0ἡW 0`5000700 0 0(K<%p00000\03/0 0C00 00 0 CH0@<0 00 bb<24Bd$24$0S8$0/ -LM4K{P@x`xpT 4K{U \KxP U ᬇP4K!{@I}AB@ -LM`phhPB<@0S 0S ᎇ 0 \( U$K[dBBvz=4 0-@p`DML!82,PK@%(`0`0 0,p$@ @@ @MP 0!1`a0 0,(p$@ @@ @ 9P 0 0 0!1'000 0,(p$@ @ $P0 0 0!H1'000 0,(p$@ @ P 0!1'00 `00 ,(p$@ @ O 0 0 0!0'000 0,(p$@ @ O 0!d0'00`0,(p$ `@ @0  O(KB"A[dDABBJBB 0-P\0L@THK0h菭 0R0P 0S 03/@b[d p-L M@P0@`Q Q10S@ 0 R    3T Q\` Q0@0S" 0 Rx    RKpH00S p00 S$00 0·@[dBBrB?B 1S/ 00f[d|b -X`P𝤀0 !`!800 (  , ! b$cDcHc p-L M@`@P0S S 0SQTP00S  @0 ,R(   i00Kp[dBB 0-PLK/0L@P 0 4P 0 K0h0BBAA 0!< 0`4 0 (   !/ b$cDcHc 0-L3x@tP03/0 0-L#x@d3P @0303/P i03/0B 0-Lx@G D0Q  !1PS e K0h'[d\d -LM`<K{yP@p圀T<K|yظ KvP zP|P \ĸw@PὸP<Kx@BI}AB@ -0LP0S媸y@`pT6ីsvP\ vPD咸,x@pwP dB\dB>B-B6B -<@LP0`S_P KhrQb -LM00P K KvQP b 0-LPiv@P v@Phv0 0-@L}w5wK0h[v -@40LP0`˄ 0 ܶ0`0D@GB -PL`0K/@P5 0 P. 0 P' P0S᠄wP 0SᓄduP 0Sᆄ4KhvBBAA[dOBbBvB -0L@ `RP jlŵuP`"vP `Yv0S Q 嬵[dBB -LM`vPPP K&P00S 00S厵~pMP咷<K(x@p刀T<K*xx冷.P |Pu<Kw@ddBb:A;BBI}AByB -L Mp0$PK,p (0 0`A<@0%0S V KmP 0-LMP,KwP@,KwT 0S :S ujK00S ,K:wuP  KP  P   -@L`K/P p P pPP0SᇃuP 0Sz\մtP 0Sm,ȴKhuBBAA[dBBB -0L@ `RP Sl宴tP` uP `Bu0S : 啴[d BB -LM`_PPP K吶<K&w@p崀T<K(w儶U $(P*P  P n@PgPP<Kpv@/BI}AByB p-L$M`0P4K<0 8 vP@@ ߂U 4KTv<K@P4KvT UKp0000/ 0-LM@P҂P 0 0 巂PQK0KP p-LM`P4KvP@@ ᜂV 4Kv@P4KvKp p-LM`P4KvP@@ {V 4KuP@4KyvKpP 0-PLM@X0K0 00 K0 0-LM@PPK0P 0K0 00 0-LM 0 0t K<@4|@4 -PL@`,P PTp  \t`@ X70S T$  a[dABMBsB -(0L 0S R Kh[dB -PpL`@ᅛ00(0p ` P@  bp0@-@P0^PUPU  PU0^00 0@\b 0-LM4Pvt@P $000 BtK0=494 -LM` :PDx@p1S d00a10S1 QQP400,000 tK[d|b\d@4 0p-@`PML 00 0 0@@圪|巪0@`Ph hhE0P`0`T TT<@P HQ@fa 80KphaB[d<4B]dBG4B]dB\dxO4@-`0@ 0 @0 00000@00C@0NcLc0H S/P ((\\81@ -%.Lj qB -@LMPpK` `j K\ 0 0   0p  0 ` oB0P?o20S 00 P0S0 0(K 0-PL@20S0o 0-@LT0t0Sl02l0T.Q.|@ 0-LM 0@T6P &0   Q@@   Pt! t0@ 0h0@@00@ % <<K0h蝵 @LcNc0u]dS4 BLi4A 0-L8M,0\1@ 0T1P0L1p000'>0a0 00p(P$@ @I0,00 000p(P$@ @ @PI/0 ,00!0 000p(P$@ @ @PH00 ,00!\00p(P0P0$@ @0 @P0 H$KbS4B ]d~4xB!BHy4'B000/ -0L@0CS0DP $`m(KhhKhLc - `0 L #@T 0SpW 0KhlPl'0S RpLa0$ R@ e@TKh/NcLcd 4 0 0 0 0 R0/Nc -LPt00C < 0 ,#0S  R0 R0/Nc -@dPL`TdP@P 2@0@T@Lc -pbL,MP`@ 0R * 0@ 0 0rp@ ẘ4 0 T 4尘 D 40H @ 8 L 0 P0 < H00 L0 0 \ 0< 0 0 @0# P @<0 0 000000000W 0C00 pGD04 @ p0@D T@ @ @ w8@0@@0T@@x0s@0x@0@0b(KLcNc0u0@-x0 0  ^ @ 0@0000@00C@0 0@(ONcLcLc 0 v]d 0-@L`|0RPS  0| 02 0SK0h0K0hdLc -0L@2PQp` 0SR 0 0 0l02l0@T2U  R t BRQW l "l  @0CS 0o  BR g -L MS40 @p4 (㤗LLS   0" R`㑗`o   #P00 U  Rx R cP P,xQ TZ" RU R`  @ P40S " W GP"QZ|PRPl`oYppWpZPjVQaU Qa R] U ZQ x @ P$  P "    " |gl  l 00 0P` 0`  | R |"QppR R| |@Pw PZ ( V ߖ(K0 00P`PPLcNcd -LM@1pP`2 @㝏K00T0S K` 0R@St2 0p 5/@t2Sp" p"0Lc 0-P0L@1P41S d0 D0SbbD0000 b -\0\LQ4A@00S  Rb0PN002Kh裲 bb -0@PLq4Q0@0` SHH81SbT ,BY`0 <`0fX|V$Kkv b 0 -]d0Y]d0Tp]d p-TRL M  [! ⑵ ,⎵0"BSN<811 <!!01!Q0X !QX2 uB,1 D03/ 8-! 0 0SL1 0 S00#0,1` ?Q( 0(1!0C0QP 0Cd0` Q?, 0,000000Ux0`*|bP  n$$KphabAAb]dbNcLcMc@b\bdblb;d`d 0-80L 婨0t0@A0x00]d0T嶳]d 0 Tس]d0 T]d p-L M@`2P/U )P*U(P)U0PK0% ,P oKp Q-L@P0 Q Q) Q0PS0  `0VP0U D00S S`0  0 00CR@blb -`0LP` x@ pW Kⳕ)W$Kk1 0 $Kkmz$03/@ ⟕@c -L\M@x  | 0 岔l  㮔x0p D0t0 `\KxP0T T 0}\0Xh0 Yp`P=0sT0Ph0 l0d0 :`0 d0KL0 0 JLK$JJdH0 @ 8 D <@ ,y LKteTP0V0l  0R]@|0 0RS@3@C 0 l 20$01l0& 200S! T! R  VX!0\12^0 000t1"  R0t12 !20N0000T1 -LM PS   40$ 080, (0<04 00@0< 80D0D @0H0L H020T P0 0%U<0@`00h@d0\0'l00p0`Ep0&~pdEp0phEp0plEp0ppEp0px0t0T1x000000001(0B(-R #0P/ / A< 0U0!Ay!1 1Rjc }Vfc00 0 t0[/h1t =C2k1d0C;00(4000 h1$1 c1 ? Hp ? t0Sx @CST@@0@$@oD0 8$! ! ! ! B"&" 0B &0B2 `] UH? 0 0@0(0h1$IEp0pP0000(0S0 0400$ t0 l?S  Q Rp 0 S0i1t0j10S  b1U ! ! 00` p0؀ ST 0p ` 0 匀 @!0KJ00 D!000 H!000 L!00 0 b KNb20S/ $0 |02f0020 0Sh00h0200 Sh00h0202 0=l0 200S R  U 0X00\0t 0BRS00 0#0i-< K (! ]%!< 0!! K K 0X 00K001010101<Ib 0 H@Tfd ? ` ? A\ ? X ? AT ? P !? AL ? H "? AD ? @ #? A< ? 8 ? E<%@Pp `0MK00!0 S=9C K =C0 0P20T2(KApA`AAAAA A @@@@@@@@@81@00e `p 0i R0 H`p`HK8A@D@p@@@@?B -LMP`p@5u410 40Su i`u !a0 000`P u 0 RKLc -L <KP@!<0pATx @"]W 0Y 01 8@P0Y@@x<0 \4>;> DKr@P ̐>0<0 OD080 H0 ;PH0 0< K"N@ ZT<WI 0 Y 018P0Y@x D0  ᘐ|=ruP% l0T00 00HP@ WI0070t0 CSR`@@ @0H0 JP@ T{0I0<Kj@P Y8000 D0 DK0(80@0HhD0K0 $0 D` @p z@@ LcS4 -LM4K`pAPP,0S ,!@T (PPQ 0uPP@  $KP -L M@0 000¬oK -LDMP0 0PX0 8@14 `4U 0s X04 `0P0(Ko>40SP0400H0 0ST0 PU 0S00 Up U0p 80 =㷏P%㲏1`07`<0 4 <0 YD  @A\0 < 01 0!L `0 T<0Ss \0ATo 0<0 `0St0S k0X00 0HP @U0媯00 080 00S~Ѐ4`4|44444 4,4xPP220$l0w0GS 20 R 0S<0Sd 00S0`0`@@0 H0Yh80T 00R0S` ] T0SRX' 000000 0 000000000 0 0$0$0(0(0,0,0000040408080<0<0@0@0D0D0H0H0L0L0P0XP0T0T0X0X0\0X\0`0`0d0d0h0h0l0l0p0p0t0t0u0u0x0x0 |0|0000000000000000X0000000000000000000000X000000000000////<< @ A 1X1 1NυN1 1 1$1$1(1(1,1,101014141P1P1T1XT1X1X1\1\1`1`1d1d1h1h1l1l1 p1 p1^^^2 2^X2/2 2 2$2X#΅$2(2#(2? H2X@ H2L2%L20= k\0h`0D X!6\0ZuD0 0D0 H0 0CH0 L0 0L0 @0S_ Z00 00S1E40ST 4 D00CP 0L S 3,:%k; (KS 200Sw?QP |0ߧW0٧0ާ0٧  %?;<P<00@ >800C80 rL0P N=00@0S R^ bLc41x00/41xT10/41T10/ -P(@4aL}200@Mc -hP@Lp`lT4120$00dP2@0@$00@Mc -`P@Lp`MT41200FP2@0@0@Mc 0-L@50 0-LP@+*0 0-L@!0 0-L@0 0-LP@0 0-L@0 -L@P`0S P 0Kh8 0-P4AL0x Dx000 R04QxR 6/ -LMP4p`Yu0@x7yIu[x ᳦PYy a0  ᣦP @ ៦P p 0ppu0P  00 B00(KᄦP  }P  yPpP    i P   e P\ PWP ¨u NP JWWppGAgXWEy Dx = - Px -L M`p4PXx0@v5wGxYv PWwk   P @ P P PP0ѨP   (KP  P  ݥPԥP    ͥP   ɥPPụP  x  ὥw  ἥv  ᵥ  ᥥP -LM 0  K" 0-LM00  K -LM0tpbt@uqPl$0P 000K7 -LM 0  / K" 0-LM00 " K -LM0tpbB@u?P:$0P 000K741`0#400/ p-L MP`V00 0@@PPKphdKp -LM@PT@#@`4q2 ,Kt[3 ,KK@Mc -L(M04a00P ç@P 8K0 @P ?T@$Kp2P0 x $0R  :P 00/x0 00 00 K)@Mc1B -h0L1410SP00SD0DpP@0Q@``0  .0V b Kc|b_BXd 0-l0L1$" $" R @$@P$(2S }/0@T*P b 0-P@LT0 u000000@ -`0L14Q0S `A@T 00P X@Uu b -@L`TP5 TK TLUJ ||!:FPUS00V0S> 2H1`P1p4 (1 0SpZ@& P% V* U&00P14Ap0@T'@  V U 0@$Kk@@ @ " @ bb -@LM `0B<~0 00,(`$@ @@ @670 000!|>P0t> 0<040,(`$@ @ @P7; $00!$>0>00/> 004,(` @ @7 0!=0 040P,(`$@ @@ @6 0!=400 80P,(`$@ @@ @6 0h!/> 840 0<0P,(`$@ @ @6 0!/>̟ 40 0<8P0P,(`$@ @ @6 0̠!h<0 084P0P,(`$@ @@ @6 0!/>8 80 0<4P0P,(`$@ @ @z6 0!/>˟ 0 0<8P4P0P,(`$@ @ @a6 0̠!H;400 80P,(`$@ @@ @J6 0!/>4 80 0<0P,(`$@ @ @06 0!/>4ʟ 0 0<8P0P,(`$@ @ @6 0̠! :400 80P,(`$@ @@ @5 0!/> 8@40 0<0P,(`$@ @ @5 0!/>ɟ 40 0<8P0P,(`$@ @ @5 04 ̠!90 080P,(`$@ @@ @5 04 !/>80 0<0P,(`$@ @ @5 04 !/>\ȟ\0 0<8P0P,(`$@ @ @50 400̠!70 080P,(`$@ @@ @m50 400!/>h80 0<0P,(`$@ @ @S50 400!/>0ǟ00 0<8P0P,(`$@ @ @950 400̠!60 080P,(`$@ @@ @"50 400!/>Ɵ0 0<8P0P,(`$@ @ @40 400̠!50 080P,(`$@ @@ @40 400!/>@80 0<0P,(`$@ @ @40 400!/>ğ0 0<8P0P,(`$@ @ @4 0 400̠!d40 080P,(`$@ @@ @4 0 400!/>80 0<0P,(`$@ @ @r4 0 400!/>ß0 0<8P0P,(`$@ @ @X4 0̠!D30 084`0P,(`$@ @@ @B4 0!/>80 0<4`0P,(`$@ @ @)4 0!/>Ÿ0 0<8P4`0P,(`$@ @ @4 0 400̠! 20 080P,(`$@ @@ @3 0 400!/>80 0<0P,(`$@ @ @3 0 400!/>``0 0<8P0P,(`$@ @ @3 0 400̠!00 080P,(`$@ @@ @3 0840/ 0l!0 <0P,(`$@cBNclBd4AuBjd`4}B4JABB}JBBBBBBBHABBBAsJB4B̚4BB @ @t3 0 400DD!0 <8P0P,(`$@ @ @[3 0!00/>㤠00 04,(`$@ @ @PD3 0!00/>00 04,(`$@ @ @P.3 0!@10/>004,(`$@ @ @P0 3(K -8Q4ALp`0S S# S;V @TB )@ V P )@0S)T@D@"|0T@Vq`)@\0PU `0S b0dP2T@ P@McMc -pa4QL@G0S S2 SPT @PUN 6 @ q`nV@=T 4P8 `PU@  @ UT`|PT`0PU `0S 00P@ @` 4TP.@@`@McMc p-LM`P V 4A @ ,KTS  ,KKp -@LTMPx |0 /%K/&K< %K.؎$KPU{K%K 0KKDpP !t0 !@0 0K&K0K`ppf`N D SRRX!V`pZ  0  #0&Q#0 Q x0S  0 D "0Qx0"0  Qx0 |0S %K0 T H0LP 2"0T  &KPKKT"0P|0D"K0P|0 0S$K t  (Kw`20V#`p##dK܄K0 $K 0$K#K,2K2 48<0@S, <K7 9K$P`p`3p30K #KRKdKPKdK  0 #0#0 $K 0$K$KK 0$K%8Q-\ H0LX 2"0\  &KPd H0pL` `2"0d  &KpP. SR8`RV`!X`p.@BD <0$(, ! /@- @`p`0 0 S0@P=9C@ =C0!A`pa0 0 S0@P=9CA =C0 0 $R 0$0X S  ?B 0-P@LT00P 0 0CP0 T00T08A p-qL M@P` QP MX <Q0 Pu ~Kp 7X <Q rP -L\M@l K4PX lKK -1L i p@0А0 @@ QPᤠ0 S 00 ;U `TP@ jQP 'U P @NcbJ -@PpP`LJPP P C@UbNc 0-@@L0S0P @0 R K0h000 @PK0h - RLMP`@p(K SR@pހ SR QPp P 0 \pP0F@ SW44$4$4$4t4L4$4$44 SRā SRāA SRā SRāЀP 0#KD040,&0ß,6 * SRK: ()#K SR0 ԃK #YX DHB0A A H 0 V@b@Nz TSRā8 SRābdblb L0 SPL0h xp, '}`p W1# ?Mx0 W xp ) P p00vP@PEP`p R)0 ,00S(  r^ P,50S(%` 00prNO00g h0 00yg L0v00qg 00 00ig KbTb B B B B -@pL `WP0 T7 X000CX0?U0;0Eƒ1Q  > @@000,2S$00$0 0S PDW0S𨝨D0 RQKhQ00T0XdHb 0-@Lw  00R    B ,"R$  B$ ?P ; @‚!^ R0A!4.! R0!R 0b /o" 0Q A 0 //(X` 0L\S000$0Q7Ó$0$0`0X0B \Q\   R\\  \  7$0 0-T0L@T@0 Q 0?S0;0Cƒ1@mC00T00 bXd 0-L00 R Q@000@@@I b0  / B0/ -L$20CS$2("R  -LM,0 0S000u KdNB^Ć@Pb  -LD -/ -LMH1Q@Q80 0000 40 0040 00 $2p0 `p`$200   Z +80(Ko0S00S<< < 40  Z < << 40 <<X 00S bd\b -0L@q00SPpp<+ EY ^UP}< `PWV0$V `X!+ 0$Kk=+0 X+0  bd -X0Q`Q ppP0LP@ P* b -PL*@  T@)< pX  `1<T@$0" S T`0 $Kk<< -`P0@LQP0S   T*@ b<00SP/ 0///d<00S P/( 0 0@o//d b,00SP/00//d00/]Ӆ -0ML< <0 4 000  C0 K4Tb, BPc 0-00PL ㆆ@000Pc;= 0-L@A=P0 ᝆ00Pc -LM@41Pp$[[.@N u0`S00 4@4/0042(K P4B0 3/4 0  -LM@41Pp$[[.@N u0`S00 4@4/0042(K RP4B0 3/4 0 P/d04!@1<h  ςP d R00@"l !03// b0@- 0S"@PB"00 0-PD@L q01S001  R  K0h0 0-P<0L14A 0D@ 0 0 T010 0Q0 b 0-PL@C0S0 -P`@LT(0S$0(`00C08A - LAB 0-4QL@t0S d0S00C00(0 HK0h" \/;ld 0-LP00C"0!300 @ 0 !A\  Q` \B000@TR0000PPP#0 Q0-L@ 00WP 0S(0141"2 0R00 b 0b0?o 0s0 c /o b0!0/ -0LP ld -LALPTp` 49$0 8$0.@$04$00F"l !03  (0SX@X t0>S0?03/(00CS*@44x444@4X4U@T $@G  0 S 0(0000S $@@ @@ 0-@0ML 00 00@@@@0P 0x00@0@ @@xPPLw7 4:8 ,,K0h躌43 BRc; BQc5X 5\4A -HP QLK :T01`  0@8+NA PRc 0-[L@:P0  0K0h;Rc -HPL`8SP0 @  +A08H@KhRcG-HP0@!q@0D0H0L000000000111 1a  A @@ A⮒ Qဠ@ A⮒ Q& Aba䑖@Q$0(0,0004 d  d 111281̠ TP00000 00 0 0 00 00 0 00 -@LNP`@T  8A p-L M`P@K`$ @   O`Kp -PLMMH`@0p$4@ 0@ ,@ (@  @ "   䑘䑈$K   @@P$@(@,@0@4p 0$pK@' 8p  4K`0AA 8AB`02 SB0!!!!!!!!  $KԆ@ p-LM`P4A%,Kr?D1(H 1@U$00L1 1 ,0000,0 11( 0$0 10 0  PKp0E"K! 03P 0-4a001L0>P@00104!H" 4!D & 0p0(0   KhJ10101 -0LP@4q  { (e` 2V  0`P 0010 10010A4" l 1//$04$0 -LMt0@0C P(K080 01S 80738 q<<0 h0p  Z' `P NPP  800C"0!a1`! 2 0S  2S02ą`$ 0,PK0% 0P   NC  N=@P41S t Rd Rp Q+ @ ܹ0P Q @  B^ "yV S`P~ Z  @Ph  uPP~$0  B "^U1St0hPS[ d RU `$PUu 0 <0SP58Q?o22cN<PP^8 U R% PP8 QPU S0S00C00ht0d01d0R /1d0XP1` 80 = 80!!bR!妌Ԇ@Qc@Qc -LMPxq4@`U$ PP1@T) `0Sx ZR000  00 000 ᰉPVP  @T P @TU(Kx0S` 0  ᄉP VP t0 CSR |@@McMc p-L|M@?x `KP<0U0 000 x00t0 y<0p lP P h 0d0 id0K] _Kp 0-d0 @1d00t0000L00K0hŌ -pL`@0@T% `0S 7d0S0SP`P iU eUV($Kk2 Z@P@McMcQc -1Lpa4At0Sd0S 1d0#0SP'd0SXP P , 0Sd0S$Kk 0 A8QU 2 b@McQc 0-LxM@t PK;0 0 |P K K0 0-d0L@60#R00SP 40$1\ Q Q Q $  K0h -P`p@LTW l0  |@ p-L|M@`Pt K;0 0 K0` Kp41$1 0/ -LMPP1`儒p04AK Id0  ػHȃS|H000 rh0 + 0Rl0$/0 S @1<`܁p ^!` 00 ;00 uP` $1 `^0# (Ko/F280 1 4 40Q 0202  '(KopGoPrpW @0 00D < {p40< D@0 101101800 11 00 0(Ko(K@McD B -LM1q Q4A?0 d0  x1Y *`h   @1(K  R @alS\w upt K:P1 儐 40 H K^⠐ 夀 p p1` ܁吠 : FZ l`~R1SP $1. `@T0K 4/މ: b@McO B -`L$MP4A x0S:ڠ01 hl   0 P, (0 ?Ⰰd0 1d0!, <us QcԆ@ -P@4` HpLk^`H9$"101101 1011010  E2 1!U ( !02$Kk;Ԇ@ 0-@PL0x (!x g K0hb B[ B -LM4APd0p  $08$0  W  _!% :d0$`V0S 0 000  Q00C0_V$08$0V8a7$0᮵/000 X 81Xxq|10 ` X i X( $03/ `ti00S P q?Vx 0 `p㖁 aVd02d0d0 :d0`$めy B BԆ@=cpbԇ@@ -LxM<1`At!4Q嘁R H0t!v2~X0201S" x1Sx KH8` ^K81܁,0 P \$1 ` X0K 8/ Y& K P KN 0KS K$K b -0`!L4!PH @"Q55d5d52x@ pW hEW$03/8 $Kkh$Kk b@=c B 0-Ppt0d0L1d0?`0S 00C0@TW(0S$0 M Rf 8AV  ^ `(p000 -L|M` 1Q4At $1K0p700 P1X@ 40 00 00 0tK␀ |0 0 x0 70S : Yd0   K!0 R @! (Kh   S 5`H0` 㠀40`K1^7  P $1.`@T0K 4/ b B$ t0 l?S  Q Rp 0S/ -LP@p `V p0 R 00@PX0`00@@@`p  @000/0S0S/ S  , 0 0!< 0`4 0 (   !/ b$cDcHc 0-\L@Pf0 @T000/ -,R00, 0$ @00 $ 00 (LQ Kh!,RR0(t `0 0\ 0C`047 `e d40(0PKhbXd 0-LLA  0( >00\0K0h4 bXd -t1taLQ0Sp lW> $0 G$ 2 @40$0$TppW $@冇@D 4q [@P 01 @P 41H0B0@@ <0S 4 ;PX , X@,P #@ bldԆ@ -P@`pLQ 0ȀS0@T$Kk 0-P@L U0K0h 0-@LP0U0SK0hK0h蝲 - L@`Q`Uʀ0!`` 0X P   !TV  b$cDcHc0t0| xR  0-PL@V0S0\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -P`L@T h.`pn!X@0SP00:#003/0:#0 b -pP0LAbP 000(p b -AL M0p00 `0 R |@(K,\`@zO 40 'aP40\` R 0&%x00`q&&`aSkd b B/5 Kc -@`0L0P a00S 0t ᅑ3dpT0000Z 0 0kTPKh bKc|25 Bkd0@-#@PC0 -P@Lb 00XP(0Kh -x@P$ML40 `@0000 0p000p 00 00 00000000tP |0d 0 0 |  x0U0l 0d 0 |@ 80U0 04"  (Ko B)5 B BA" B -|AL` pQRѿ0T!>0>00Ep:E?c6(:&`p 0lK` 0)PP4 EPeE@PZEyEPTAEPDT0S; 9X`Po_ 0P/{S SpPI SXD0S6\P S"P\0S  :pP \P0K*P ?Y L\ Z8ER*D"0P SPSXD0S  D0S X00P0 p\Q! %0X0 D0S 0 0S0R0S \0SW 80S@5P WR0 ZP P0p0 084s$3   0` Z 00Z-0PWk ۧh꒓!Q00 00 `08 0 %0 %000 0`0 QF:8帧8`04 RK40 040K 0W0 0440@P4 0p;b0  RY 0SS S\0[00 S\000D0H0080P0SL 0(  SI0 00008 P@R `08  P00R:`B 0 #0 % 0P@4P8Q`  8 P 0Q:%K#\ ;0 0@( P0\0PE0P+U B Bbb -LMP04S ` 4l@Q0s0S 0P R0p@(K0 00hq@P0p@020p V 0K0 0K[@P` K$84p 0[d`T@ RS K1 O#P 1Z Z @``` 0 0  R4 RB@ P 0P 0000 XP 0X0`p  K$4 BT*0B08` B#04`8 `FT :`0&*`  <$P4@@DT4@8v0@8@P0S$(00X"0 K00@`  R @` 8 P 8 4Q:P(0PWBb p-@PL MP0  <0`0S 0  KpKphld -L|M0 00 00@p$R k@70S@3Q0s `P @( 0T8P000 l 0K0 0Ko@P40S` W`0 40S@ @@0 PpP@ ڥ(KT P@`0T%d0S ( S@2  00 W X0S 㙥Pv 0K0 ;4j@Pf ᬥ0PQ0p p@00 XP 40X00'0000 40S6r  0RV00 "4H+7#XPM00 0Z0(00000C0 00  S @P 00B0 00C0 000s% @@@Y@T0k ^$@P@ @a X#070 4@ 5000 oP`P0K?. P +"Bb P0-L+@0@@@P iT: (K0h蜮03/ldbH\B\Bld 0<0/b P-L Kh?0!,20,2ld b01, bld=ld -LMp0S1004 S0 0X @04S8P`` @3j(KU 00S0@S`Y!400 /#'000 %40 00S*0 0S   R0  0000 00000 0  0 00 nP 00`@00S8PPVbB -L$M`PQp 04S i,00K0 0t H@TP) P00Q1S0S ,v5v5xv5v5hv5v5x@00 F0 Pp 0 4/(KW<@W0@(@$@-@Bpn5Da5xj5]5$y5w5 -LPM0 `V@X0  0B S P XKLPP $KTpK!XAPP00S 000 p000X0KkPV  XK9UPU0S X0S Pld -LMp04SP`@ (iT 0`0S0V0S`0 KPU -(K0 0 K0Kp P0HpW  0 0 @`0`0 0 07/B -L|M`0 0@$R p hP70SP3Q0s0K00 0K0 PP"d0S"W@ 41$1H R@ ,0Kd # D@B!@ `P0@ 4@800 `40 S0(K( ` S  PQ( S  800S  P @D RT0`00 0S X_Y `0 P``Y I`IXPB -LWMh1 0R@p`1  `VXh@`h1S0h!0T0 Z4040d1 <d1 ,0\1 0X1 XQ YX  \1 \! P,0K 1u Q 0s Kl1 #Pl1?@uPP PE, K !  1(0W 0 d10 @ @ @  d1 ( W" W W`10000K@`0@ @ 0 SK,0KV/K(a#  P @P  KXg`1开 0 $00 T1X @00KE0p>K KPPKKP D0R0 sR j Kg@eP0Ph1PZPSPU ,0KV/K(a#SK SP 0`TX 4 RSX! g8``'`q p W0S`1X ZT1 p|PU8PP @P%h1S T1h!00S TQX`Vd1w pȡPt   0X@70(K@ 0p0 0P`1Q1P R+0p`1GKS  4 0X!0`l! 喡P l!o !嫡Z 0`  0XGK00P RQ `1P0S`!g`1  P0!p!!W P 0R0C 0`1p 00C 0 01P`!A(   f0@X0h1SafB6BBBeB --L0M0 00 P Uq 0 0$ K!0s  $0KPE #pK K  X@P RT@ KᄀKX |K`开 40 $0K0   ` $0K@# @ ` pBP@  8040 @ P0Q 0 ` `PV0Q S0 XP TPP ŠPP 0 X0 XP' ?@ -`L 1V`04S8@Pp& 9f$Kk  0P 0p`0 P p`@48`0D"S*` Q0Q 8P@PT 00S`@`8P P04p0pSV8pldbB -P0 Le0 `娀娐q Rʘ,Koe s@ S sheT@ e@`p0e@Ce @ BaAA3B*B~@ -LMP @T 匐KE`   S7500(K Q  0 0` PPqF1$ d 0 0 0 0K00K7 P010 P,0Kd # ` P 0` `ld -L$M@ `S00 00 ,PKp500 0 00 00oP@@U@T 0PU PPV000(K -pL\`@P8e0WS T @00R01 N@00-9BQ|,-//0 R/ 0C- @`p`#p#0 @P@ @`p`  0/ʚ;  0/@B 0/nd 0-@P0L3/0@000@-(PP@@0T P0S0b 0-h0L@P\03/03/@00 R @!QP @$b 0-@Pp`DML!l10p,`0(P00K$@ @@ @P  00SG 4p0`0 ,00!1 000(P0$@ @ @004p0`0 ,0@0$00'!0 000(P0 @ @004p0`0 ,0\0(P$@ 00!H0@ @000 0(KNB5ZB5aBndjB -LMpQ@K`@ 0 !0K` @p0  0 000 00\@ Lp 00V0PoᨂX cP 0S 0 pR`V0 hP (KP$`03/03/`0S =bJcnd -LM0 0 SQ P0`p0@0YQ0P (KVpP!  p  K VdY  0 0 K ᴧ 0S0`PpG 0$@ndndboA{BAA -L,M`r`T@P0PP0 P 0PDp S@  03/@ !! !0$K" #0#$K!$K0 "0S 3/a0 @(0K, K $KB@5B -pLMP`K` @0, Kd0"0\ @ 0 0` 000 0M@@P@T 0S0(Kc0-#@RP0C0g0/ -@ MLP` 0 (0,  00p@0004 HPD` @f?U V00 P 0d00 0K T0 >PP  00ZgKvfТBB5 -@Lˢ@0`0@0Bg0PU #0 [fKh賢2gPQf 0-PL@ᨢ0S0 -PL`@ P 0-XPL@U {MMPzMPF]MK0hF b -L^B -PL`@TPKhf DP -L$M0@`0 RP0S; 8r(PU; 0XL#ტ Y P@ eHD @P R00P 0100K01}!X  Yt!0 he@0Fe40 040P04000 xf 0R 0,0 0 M00S0P0(  R( ,0 00(P 0bҡ 0R 040 0 PBfᒏZcBB5|bB -P@Lᱡp0S @@ 0S@0 `V* 0R 040 0 wء4e0 Ya+e0 ^!#!3 DeP1$ T101T!1审ᬡ 03/e0 0040 040@040 bMbZcc|b -@\0ML 00@@ @@@$FW  00@@Kh2 BZc odZc 0S-Lp@`*@Tg`BE P @P `:EH0W P@@0T@SP P0PT T`P%@@U )`E@@H W P@ odZc 0-@L`%R0@P0ST T % $T0`K0hDZc -0SLpPR`a` PULD@P PC0W PpKP# P3K KK塠0PU,PS 0 0@ 0@!РT PPtY PD hPP P DRKD W P odZcod b 0-@LTa!R0@0S   唠T0K0hZc 0-L@(KP/K0 0-@PL(K,K@'K0 0--L M$P@0`p $0 +\0p00c `K -P@L`V O`c 0 $ 0Khcꐣ5B 0-@@PLF 1 T!11 hd000 b 00-SLP@0:۟00S ,0 0,0@0,0JdK0h 0 0R40 00 000 @ 00-SLP@  S00実 0R 0,0 0 .00 0-L@PP00S01c -L|MP冟償`@T徟(K 0R00 0 p耄0S ( R,0ؐ0CP0ؐ x K},00 00 00ܐؠ|0 哟 KK@Mcod 00-@0000L0CSh# 0S 0RD 000 ,l00CS  K0hdPod(od( R/0S/00 od -@L,MT$HQ%X$;(K0<KS\w%$KK#KQPXU4PUPPHKdKKa\1ÌeȌ6̌USRB4` VBx和)40L0KlH0 s#?PD$K,@P`>.$K 0p$KPXԅKU$K+  00  I0  CX OKRPPR`X0S0PS b0@ 3 #0aʚ;odɚ;ʚ;H5 0!< 0`4 0 (   !/ b$cDcHc p-L,Md!@`aPVʀ0!`8!00!(!   !4K#KP0, K0CS<0 P K < U 5]00D0K0 0^P  KpKh0< @ T R 4  b$cDcHcʚ;Xdɚ;6e p-@`P```0ML 00 @`@K40 @`0@0 BKKpodcB%B 0-8@P0LP 0川 0od@5_ -LM@$KaP $KrKQJ/ 0-LM@P $KFP0$ K4K0 P-L@ PTp`0 QP00 0ʚ; -LM@$KPQ  $K%K -LLM\0Kh l 0 `0KlhLbP <PPYP P 0 P(K`0刡S0`0 Y,0K@C @0` `#PPP?oY20SJ LKhZadKl0D P0 0 C\P  R00 00 ıU(l`P` ʽ%K`Vp 0T LQ V0  ``Vp 0 AQ V0  uPʚ;/B p-L,MP` ,K{@P0S<0K0 ,0Ke@Q 0 <K‷P@Kp -L(M@p`,K WPP 0S<0K0,0KB PQ 00 <KZPPPK -LM R R S41x01 K0 @ KSP12 -LM0@S 0Q  ,K,0 (0 (  $Kx$K $KP K 0-RL M@P 41dx rYT U  4KP 4@K "K/0$K K07B -LM0 K -pQL` Ѐ 2 0 0 @P 0R @TP=)@ - `8VPH!0#0@_0( 1@01$Kk![dnd@Bod p-0,ML00`@ \PPP4!P<KQ,KQ  ,K∶ <KkP PKp -41pL` G?o2!R0S墛0!Rޛ00CS 0S 0SS0<EXPX@@TX@ @X@0odɚ;6e -0L@0CSDOP%0XP0PS^0" ^0S'%0XPm 0R 00P eЅ WV.XX ^-R< 00S0@@ XP:000@@S  Se XPX  RX  X 0X`V peX X BRX `Vpe X R @@0%e`VpX0X 0CSX0`Vpe0X0odH5ʚ;ɚ;6e -XL^ E0A  T0%XX%0NQ^XЄ 0HP P`@0XQXUZ@X,0PE0X0 -Xʚ; -LMP@@0 CR5  R S4K5!cKSR,QQ 0 00!$KR R0,AQ R0!000 R Sd ``\\ %XQ 0!ʚ;ɚ;6e -L\M0 0p0 @`0 ?o2!R0SlK\K]PPLlK]PPH 0ATGP=LK@@lK%0X0S 0BQ0*SR|K#'K 0%X0t 0!X0S  X `p WLK(KFS |Kv'KP 0%X0t 0CSX0P5k9 RPIZ@刘 0 $RQ0 I# ^Q0 W  T(   T  , 0p, xptpp x 0 ]V0 @@D 0 T`pp pXpp,@K 4( 炘  (odod -LM0q KL -L$MD p`[P  (K[P @D00@0 !00S@0S @ 01S @01PU-T <|G@@0SD@  ( D 0pP  GRppPPH0 H0W$555$5 , @P@Ϡ0X $ H00  ^00S W W' Hp T H  <Ka#K 0 X4%D0XQ1 e06%X<Kod(odɚ; -L(MPpU`@4T0S T DK$P $K LKLP H0 qP D K4 -@LPT`<TV`M `p"\ 0 Sd0\0 %X^X 0%10X000S0@ 0S QJS X` p De RX (X R 0 0 `qp0S `$V0S( 0S%0S"0S0($Kk&HX0`p^`pXe R 0$Kkodɚ;6e pd 0-41L@0PS0嶖41@T U PU /d00P@T /000PxK0hԖodxb0@-4P@ T0 R000 -PL`@v0S -1LQ 0@gPP```Q00$Kk蝖0  0  CR+R RC400 0C?ʃ10R00 RC400 0C?ʃ1RC80# R0%KV&K/X0@ TP!@#j? R0@@T` !0 0KVO|M `0 <KT;00#K$K/40@A@`qD 4QW0ʀ 0! `! 0    !LKT 0!!`q0    !M(KM`X0SxxM%K#K040 ``O @f .Bc5BQTB b$cDcHcBBBBsB -LMP@U 4K0<0#K`RcK 5/$K0S `< H00 <0VR 4 K[04K3/pb -LMH@0S $K"K0 P $KP MKcB -p@ L0 0aPUTF5@4 YVP `0SPT 25蠑d -LDM 1Q0@S @0*pl0!(0 0 40K0,p$@ @@ @`U\\104 K00K,(p$@ @ @@B104 K00K,(p$@ @ @@1004 K00K,(p$@ @ @@ 004 K00K,(p$@ @ @@\00,(p$@ @ @@00K4 K(KXbdBl5 B(B/B7BB -@LM`0p  ^0PQ "@K` 0 0 K\ hN)P\ 000 0 0@ 00 0000m(K@Tꄈ@ 0-@LK0h 0-@L K0h} 0-@LK0hs -@pL@BP`h QP00T00S dx`4!M!40Ѝ/0M0000# Ѝ/ p-LM`0F S#*@\Pb,K#2[ 092K$0[@0<<,K$0K姪P@TKp -PL`LPEU@#0T090D0T@0<<0D -L(M0$00 0 00 00 00 00 0 00000000 1L K>B -L(M &4K4K kK KJ}A -L M @K ! 0  "$  "$   @RK 0-P@LM K0 P 000K00K1[0E00K00K1[0E00E0 @ E S K0 0-LM@P `0b"!4b4#K0! +(00 0 0 0@ S K0 0-@PLM K X0b" @!4b4# 0D D00D0 P D S K0h R/4!"?aAt R/00/ 0-PL@0S0( -@0`pL!DM,PK@%(0 000,$@ @a@ @ 800S) 0 t0 0 00,(00$@0a0@ @\0,(0P0$@ @00a0 @0  (KG'B|bD\cQVBD9B05oB -LMp0` 0PR@ ?|0K ` 0 KL 0 0 000000K?  D\c|b 1`S-L@PkLp T  PE\U  0t h l  Q R/h R/R㕧44 4  4  4 /D\c b 0-(0L@ CSR0S0P0^ D0+\F K0h0 DId/ 0- L@R0(0 B K0hDId 0-@LT08A 0-h0L@S00; S :#0K0h000000/@Yc -`0LP @崍p0@ 0 BJp`0S @0@ P #ݍ KhٍDId@Yc//00/ 0-00PAL0 00K0h b/// -L M 0Q㌐p`P0P@(K4 00 :/@P`004  809/,0IQU 58/P77tB@ -LM!PP0 `pEV @80 4 :/`P4 80 0` 갑d|bMb0000000/c 0-P@LT00 RP @ P-L`P@ @ 0 RP @T -@QLP `PQ 0 R P0s @o 0-@LP 0Rx 00 00  @ 1 Sp1 0l10 000 Q00c 0 -l@ 0LP\l`$0S(0S,0SP,(0 c\c 0-@LM K0 RP KU 0SP0S   K0 Q0 P\ `P/0 !`8 00 (  , !/ b$cDcHc@-0S a      H   WV 3R HWV: 0!< 0`4 0 (   !/ b$cDcHc p-P@ ML ͊` Ȋ0kNl0P ddH0P TTtP0<@@000<04 8P 4@Kp谑d\cA:B5@P6<@d$cc -L8Mx080S0000\ ,00 P (0  0 '. $00 0  KccBB p-LM@0`0P ` 0w@TKpLBL6 p-LMx0: pPR @: Hz.T`@LA @@0wL0 @H@0wKpcdWBL5 0-l@LL0P 8x0P HHFL0P -x0P  FHLK0hD.갑d@bB 0-P@0L@T00 RP @c -LP@Pp`  0RP `VpW0  P@ 0-LM@PPP Ke0Q P KZU0S   K0 !R  R 0P 0-L@0P0K0h 0-0QH0LP@ K0hP0@T0c -L4Mp@ X rPP? @0P3 P -0`@ ^-@0P0@08`8K 00D0H00値40@0` QVx V A8KxX^ @ !R V !R V`$  $ X 1T0 0XD0 $00C$0` 0 P0 qTK-H ) P0S eTHA- D01L0 D0L FH0!4D0S L  HH0` 0D0S ELPQ`,Kj XJ000J.K J 0S yE  0J  ؈H{L0 Y UW,p000p00040040X0S @00P,<0 < 010 X<!20@ !x@W @P\ 00S@ P= p00aV3 P0 0S 0P@0 P  pP 0c! D D R   @ P0U@ h W(K <@x@c\cBBBBBBB8BBB -LP@`z0P 0Kh/ -@PL`U 0  5/0S` -`0LP@p^0Q Kh  R  R ! R -LM40 0p00 0`,0 (0 0< 8 0PU, K@0SP X 0S 0C8#8SV  0R PP <K@c -LM00 K 0-pdPd`LM< 80 0 ,0 (0 40 @T, KP<Kc6@d$c -LM@`ቇ(0 Ƈ`(KQ$00$0弇90S0 S401 0S. 3/`P*40040,P)0X- 0S F`8K$VA$ (0Q.(0S+0K8K-`  C0(0S 3/ppP  0RP0WS0!WRG!(0,0\ccAB -P@Lp:P`U Kh/ +P0p `00c 0-$@LP00P0K0h,갑d 0-,0L@SPDiC*00,0@ P@  @ @K0hABc 0-l0L@0PSK0h/*0040@ PH  H H40@0400Jcc 0-4@L᥆P00CSP00KK0h܆갑d -`p@LTWP 0,0S 0U00 03/*@ 0-P,@L<DK0hc -Lp`P@PB0S0010S1 10S- YCW,dDPhE0@10X3|0 03/40DDbD D 3EU 5/PPP 0R P!U0R0US㾠EsBdJcBcBcBB -LM`0pP0 @P @0 iKT 00S 00S BA4/d0,\DT@ T pP\ᛯ0 Kȯ갑dJc@J}APkd -LM0 K -LM0  K -LM00  K  -LP`@P 0 KhCDB 0-LP@P 0S00 003/0c -|P|`LD@Ts R0H0 03/ 40@04040"CJ)cB -0L`TpX 7/Pd@LPU /)PP0p `0P0P0S 0S P갑dc -4AL,`P0S01A@0S-pPL@T*U0T0LP)=0P0 H ӄ0S @@ U0U  |$Kk@l^H 3/0 3/@P R0P0  (갑d@c|XdBoAK}ABd$0$$08S 0  |Xd,5dd 0-@LPH勄T 0S 0AT (0@忄0@\c -L Kh 0-L@KP0K0h -/oP"@@Q@TLpPA` <PWP@PE` T4 / 0-40L@ 00S400400L0S 3/P 0-40L@  00S400400P0S 3/PT0S //%40L040/ 0-@PL0P0L40ll`0400Sʐ0S$Kk$pG yG m @o 0-L@JP X0S K0h/0X/ -`L@᷃p40P" 0Sژ!Q 001 0P0 00d8GP H00C00 $9GɃ b @ 0-@PLx00CS00!G K0h諃 @/\/ 0-40L@  0S 00S40 0400`0S 3/P 0-4 L@  0S40 0400d0S 3/P0h0S //&0\h00l0/ l00-SL@03/0\0`0d0l00p/ 0-4 L@0S 400400t0S 3/P0 0-40L@ 0 00S 400400x0S 3/Px00pt |0/ |00-SL@03/0p0t0x0|00 -PDL`P@D0SH01S 3/@ -H`0@DLT Q&0pT PE0 S:nDHpT & 0P@!!0!0 -P@H`DpLT1S S@ R TB 0-@LK0hm 0-L@4o00@T$ (  B B$ ( K0h褁\cc p-LM`4KP@P4KU00 -@Kp R 0 R4K70QR4  R%PPPP c_B p-LMP`4KP@4KKp U 4Kt@P -LMp<K~P@T<K$KT `n W j `P<K@4` 040 0S 03/P U4` 0-LMP,KIP@,KMK0; P ,K -LM`@ $0`4 T 4 4K"P@4K&K0$0SP4KpP 0 $03/P0Sc -pMLp0 `@P@0 P@P 0 0h0T$K @P p40 p p0 A(656P6zB -L Mp`@P@0 P@P vP X<@@0L L@P 0 0,0 KBP66B5(6B0/ P-L o/0@-\$ R P 0|@ 5S0^4C0200 R 0 @b34 P000T0 B 0 -LMP @RP9R#b!r0 "b0   R 0G40 0Z0S:PE | 0W  `` 00s S:W  p 0PC0PUP5(K40 0 0V* <00B 0- b B30L ; 00B -L$M@ `RPp#T@@0(K |  0 S R 0` 0 ; &bGq ᐆ# I4  Z R B0  T1rp;!Y8  10 @DpR05 00040 00BTB0- b B30 RB  -LMR`pP U0(KR<6 S#B"0 R H P㐤# 0  I8 0 R R00C0 ~ Y  @@ 0 B4  W1r`);0 Y  00P pG 000 40080 00}BB Q-@LpT, TP"!bIX:V T0 pG PW T0 pT0A0U! -pP `LV:a"0@ p`PR"0PbR 0-@LB"K0h=" 0-LM@PP 0 S  p  B K0  - 0-LM@PP 0 S{  K0 -LM Rp@00 Py (KoY@`(K4  @T00U0SY RR00"B`#180 0J40 00Y00U0S 0s U :@40 PE80p `P40 P -L M@P 0 S 00C 0K -L Mp@!P`T@!@ wX R BW Ki+ 0-L@PPT0@@0 R:  P 0 -0LMP,@K0$0`Рp̐W 00S" 0 00000(K p 0 P e 0 Pp 0 00P coAAA‹A -@P`pDML | ,0K@# 0,(P$@ @a@ @P pH00S 400 ,0L0(P$@0@0 @a00 @000(K(dB,d86B -@P,`L| 0 P@ |(dc 0-@L\| PU H|P08 0S  Q |0(dc -ML M0P0 ` Sl9`dqdu|X1@TU  R*BK+, @8BK+ @&|BK @$zW| RXU 7P X  Q@@XU@@$T  Ts|(K < k|F 04`03/Bb(dcBB0/0/0/0/ 0-@PL0P0$ P  0-@(h  L^z DKLV0PDK0H0K T P P6 DK0 00P0S6~z K,B6BB  -L 0B0d 0-@LLܦTu (g=z K0h3 -@`L(MpPz0`6 P`V  DKL 0DK DK\0UW# `V`F` 000LP0ͦP $0K # T P ]60  5>PP0SV Pz$K0sL妦0 s0LP0埦B -PLxMp` K'@T(  T@%0S !`x0 }0D0 0K00 0 000T` 0000@$K cD60d -LMP0`Sp m!@K0 LP0K` 0 0 00000T@ 00g K cD60d 0-SLP@ S 40`H0PP1y(00(@ny0$@4@ -APL@ `yPpW0(PfUy b -LM$ 0K#8 @ JI K\c -LM,0 0K#8 <JI K\c -LM( 0K#8 @II K\c -Lx 0\c\c 0-,@Lx 0 K0hx\c\c -L,Ml2`@T@ XRXx50S @x%@(K05040 408080<0r<0@0@0i0$P RS0x@`!H^ ',N BR b(H^* PS"T0H0HLL$ `pCQ#H0T0 H0P0 0W:10HK x WTPALKH=<K$KKP 0#K40D 0CS40 P5k9K <40 #K0 0 YX4Z 0 0 pP$`^x(@MrJc\c\c -d`LP@X x50SDKhHx$ 0C #Hp` D`\c\c 0-D0LP@8w50S DQK0h&x\c\c 0-<0LP@0w5@Tx0@\c\c -PT0LP`w5@@$U@T ,w 5 w\c\c -@`LPpw500#T0S lw$` R$ !H0w`.HU 0 \c\c -p|0LP`pww5 W@@T Lw0S0w$ e!H w\c\c -@0L@`4PQw50SKhwY\c\c 0-80L@P, -L,M S 0@0T ߒKh0141D0S Ꮠ<0K40 000 08 $ , < 4KD , (0   0 d_> bb -L,M S 0@0T ᮒKh0141D0S w<0K40 0< 8 $ , , 4KD 0 (0   d_> bb -pP젟LW6 P`@T0``0C0 0W@1R 040 q0S0 P0pG0000C000C0  ]d_> b-@T0 pUTT#*A/ -LMP K`p᷃@P0  5@ K -LMP K`pᡃ@P0  P@ K -L MP@`pvPPAv@ K u(Kz 6v4v0 (@(X@McP  ۑꔏP  ӑꥐ -Pp0LA40 D`P$20$2ᴗ`P0 S͗`$@P$(2S 41 D b/|//ᔗ/// /////,/Q :Q   4@o/49@o/4/4!@o/<0/P8/@/ -0L:oP@- |0x0 0^@ T000Q@0<0 0 S Q000!c!ccc u@d -LM<0 ?oP2``VpP8 @T uP4P 0 40 RXj 0S 444Q80 SB0 @Q 8@ @P@  `0S000S000 S RSR@d!RX@# 0 <1SR ꞣ$@Q 0B S  P b!!<02 0Q0S @2 2t20040R 0 SPPZ0 @.1SS  &`R 0A S  P a!<01 0AT@<004 0@ 0 0S*`0@``P <K0P 00 `FԐ   P A0@ 8mP 00@40040\0@0000Jt@(Ko30Q0 @:t@d c c@!c!cD@WBc@cR@rB c -P`$@Lst@d0 QP (0 $00S00//!c!c0 QP (0 $00S00//cc40 000R0/\ 0!c!c40 000R0/\ 0cc 0-@LsT00Sڤ001S 000P0\ 0S@Ds@0 < R0 AT@s@d!c!c c ccc 0-@PL@PKs H0D00Q@0\@}s0 @d c c 0-@PL@P,s H0D00Q@0\@^s0 @d c c -L MpP@$ P s0 R `V. 00 N .P00# R 0 B RPUl*sPh00S\001S T  x0@0Ds(KP@d c c!c!c -L MpP@$ Pr0 R `V. 00  P00# R 0 B RPUlrPh00S\001S T  +0@0Dr(KP@d c ccc -,QL@ T sr10S101S 000Q0\ Q `p(r`p 00Sڐ001S 0|x $@ ZFp_`!@80 p `or@dcc c c!c!c -,QL@ T r10S101S 000Q0\ Q `p(?r`p 00Sڐ001S 0|x $@ ZFp_`!@80 p `r@d!c!c c ccc -@PL\pq`8qV 0 $Kk/@d -L@P`pP 0 Kh/ 0-@LP000$00 00K0h/(c -L@P`pP 0 Kh/ -L@P`pP  0Kh/ -L}P -LuP 0-L@PlP 0S K0h/0 -L@P`pYP  0Kh/ -@PL\pqT`8YqV 0 $Kk/@d -L@P`p:P 0 Kh/ -L@P`p&P 0 Kh/ -L@P`pP 0 Kh/ -L@P`pP 0 Kh/ 0-L@PP00K0h/ 0-L@PP 0S K0h/0 -L@P`pP 0 Kh/ -L@P`pP  0Kh/ -L@P`P $0 Kh/ -L@P`pP ( 0Kh/ -LP, -LyP,/0S/!   -L$MA(0qp#F0@9q@A`a0Q |8 40 tQF-408 d \ P 5/##K$0 S,#K05/V? Y$ (0R9ԃKB08 0  5/8  0, 0 0(Ko/Y#K ?x#K5/$00CσS 0Ġ ? 0<5/(K7`@7BBBBBBBBB -L<P0S -@L`P `ol o0t0p0P0 0T0`\PXy 0-@Lf   X0 -@l`LPpioH@T @ U@ 5/@o 0-@LX$ P 0 0fk K0hf 0-L@l;o`K0h7oX?XzXX< -؃XP0L`p@00$A ? ? 0SR T 0 P0$@ -L$M@c( 1PV"6 001 ‚dK00(K8Q 2 P帀 pN `n'3&8 ><0 0'3&>@ D0 '0p08!$0a ?#K00/`?p#K 0p;40 400 dK#K 0p`#KWVdK R0#K0 #KR040$K$K QP #K 0 SR06 00 ( dK`p$0<8 09 -@( Pb$+L<8 (   $& , 85/Kh 0-@LMS    $0  0C?o2QP R\4 R1 P$K@K008@Q| AP"0K80 S  a"40K08SBB -LfMp2PQ` 0Q 37Q00 RV K!0# 0 WV $2Q) 2Q| 46C!0CQ& 1Q v D1Q`  6C0CQ( 1Q_ 3C 5CQa  ⅲBQf/Q m?Kf/"(0RE/ 0 S0;301&6`0)0!R!  0S 2      *! R{\x P  sz  2:Cq :Cm 4Ca gd@edAd@d@{dЀ|d -0`S<00@$b /o bP c0?o0cPT00L$H\ R 0S,1#!b`!p  w R ("( R ("($ R 0 +V   LU `   hV$Kk=\ 0S ^  0$FBWBcBuBB=BCBB -80L`SP@(pW {{W0sf/< S R8S|PT Htf/"0d0?o0c QCP Q 0202 0P 0R*WEV -LMP Yp`D p@Ɵ$ 4&<p`PA@Kğ` 6$:&@#K ?`p( KP  (|(  (:@P( T L040 $0((`$K%(Ba@B@ B 0p-LM@0P0 K`P\K]P 

0,p0(`$ @8m 0!0 0'>00,p(`$ @8Y 0!`0,p(`0T0$ 0'> @00 8E(K赼A6A4c6UB6ԟ6B 0-LIM@!< K0MKP1P-@ T0d^c@ 0-L@@PP0UK0h00@000S:Ow/d^c00S:`x/d^c00 R ! d^c0 d^c0 d^c0 d^c"1/"1/@-20pa @A t a00~Ѐ0-@00\!R S0d^c,0 0R/Q0 /d^c -0L od^c-00 0R 0 d^c <0Q/1S co `/ d^c -@0^1 0 co ` d^c-$00\! !0d^c-$00\! !0d^c-$00\! !0d^c -@pP(0L`VK@Pd^c 2 2 -`p@(PL0S𨝘Q @d^c -`p@(PL0S𨝘Q ໷@d^c -`p@,PL0S𨝘Q ķ@d^c -ps`PL$M0 @T(K?@ 0?T0; T T 4 UP1@   IT`2:0 0H39c -LM 0@ ^t0  5RX 1 { K<4  ,0KP`c^cEd 0-LP@P  '0- l0B ^\0 15Q@ 12 q. 0 . `c^cEd -<`$K謓d bB7@.B 0-TL@PZH0 0Q@  C B ?"@UZ0谓d 0-@HPLZ0S00  R  K0hZ0갓d 0-P$@LpZ,P0P4PZ0谓d -X@L`aZ0PUP 000041x0,0 0R8PPZ谓da0 -LM$0,P 00 + K谓d -APL` 8@3Z 0QGPjZ谓d -ALp`Z 0R$ ̀PU+ 0@@T @E@D@T@!T% IZ lPYU0@T@ 0TX 40Z#P PPP &ZP갓dd -@LPT 4`40H0Y0P@0PZ谓dL@ 0-@0LR/ 1R >0R >C 0CR  0,K0hz*0R :>0R 0`PY0P$PBU 0PYP00$ 0040 K0h#*|fd~fܓd -LM@1p8 R` Px1 R0S 5S -@0@80(K茀K`  ,0K d #\0 0` 0 0 00 00o@V@W 00@ ʪCY0` P@圐U`1|YV@ᲪPEUP!U @ s0@S 0 `T0p`FP@갓da0ld Q0-0L 0x@PAtP Q UӡUӡ  P 080H00谓da0 -@8ML XF<{ 0L ,00@`\!p0 000($@ @p @`P.50 ,00!P00(0$@ @p @`0 $K谓d`BH6`6eBpB 0-`0LPU0P@00S0X$E40S L% K0hXJcdd 0-@LP0SyX 80S 0P080 Q P Q   Q  0S0@K0hX  R  ^ PJcda0 -LE0d 0 Pd0|d0zd0zd0  0z bd 0 zd0 0z bd0 zd 0-$@L WK0hdwB -L@PW`0S 0 S 0h0&X5/TW0L0Y 0-$1L@S0 1S 0 0$10R>$ $1  S// 1S/0R> -LMP`AV pQ03/h(KQ 0<0 000 08KD` 80 D0K40 @@ $V8Ku6p& 1Q  $013/ @ Q$1$ b6-$1R00$1H 1S C0H01S/ < 0-L, @$0Q  K0h bR>$13/  -P@L M70 S6` 1p`00 ܠX0ʀ !` , !! 40 +  ! !40`1000  !01000(KoS`c bDcHc$c -LMp` $PN@@|U뀀N@@PUU  p $0K( #R (P ,0@$K Pr& &`c bKc 6 -`@ML᭄@ #K`cT6B 0-@ 0LP0E 0`c 0 !`c 0-@L0 0 bx`cЄ`c 1/ -L`P@ R 4/Kh b 0-LMP,0K( | @ K0`c 6T0 0i!pc -LM  T$0K*] P Kpc -LM`p0p+T@@\ @ Q @p0h  KX@ @PT RT00S P  jP0h  cABB -LM  T$0K*P KEdT0 08Ed 0-L@M0K #0,(@@8P$  A ὧK0 6V B -P@$`LT0!5/@ B -LM\ h PP! Sh 54585: @R  h  K茊@9 B[ B} B -LPMB0R01  CK)0`p@1 1!T 10000P(K101 !0R hCK⺘T0l 0 0 p000 0 0 <0 0 D00 H0 0 L00 80 0 00 0 40 0 0 0 0 0 0 0 0x 0 00 0cK0 0cK|0  ^5 !h ?'K<1` X l0 @1d0 81\0 %K A$K> $K1 1 1\ 0 CK募P1@1 0S1 #KK1#KKgKfKfKeKeKdKdKc\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -@L`P,S00p0!00P0  S<<<Q 0 SQhhP`0`00@@(KJccdc@ B ddc -LM HP <P88sP @,㑕*0 ! _ p@a╌ p`@0 PU*0P p0`@0  |0 p`0@0 0 @`0@0 d0 @`0@0 ((K @Eꠛdd Bdd B dc!BTb !B!B!B`d / -tP`L@rP$R/`0SX 0S jP  000PpP`0d3/LP$R:l0xp0l0l00SpP pW000nPp k  P b ("(R   ! ! !   B ‚p"pD  BD H  H !R  B R R 0 0 ! ("(!<R R R 0 0 0S0000D 00,0R*P l gpWOh ((= RKAȊ@'!B -l0L@ Pp W t`xP9l0   t@OOW*:l l0 tOT03/`P W`0S d3/03/`P p0@PPP T003/W t\Ol0 :l0W tSO0$pS00P0P0001<1`  p0@@000000!0 0S00D 0<0 D p % 02S0SP80 x0S800000l0:l0  R  0S*#Yc 0-@LD ,0R0(@P p0 -`L@Q1S1S0 1 pN101O8O0 0$00 0@ `00d@ 0-PL4MtpH0 `Np0 9 04` 刀S@T"h * DK@4?o 2Q0Sp0F 0 0FC<0P/:0h 0ll 04 R @T 0S @T @@@ 0 .T04@ S DKp@4 0R:"01 0h  00S0``10C1000D00D0H00CH00Sl0@ 0l0x!R+00 0080S4 SH K0S000VNHK. K0S   00S0@0@0p0  <00CR0S   00S0@0@0@ߊ@;!B@X!B@j!BYc -P`L@T0S   T003/p0@ -4QLM@M` pP0S; R!0 0+R +MT MX \0RT \00% T MMT 00CS0T Mxt`MM0PK0%QMx#}MK  ꘛdcd 0-@PL13/K0h -`@TpLTP0S0>S(@1 P dd -LMP@p`  MP\ )#K2M΄ 0 ! #KQP gM(KX  R 8! 8! !.`p` -L M4 !P0 刁 0 @iT@h!+RG@ QP T )T   !  ?MP  L΅ 0 QP LT@T>C`p`C L0A4(K8A8\Q@^ 0 LQ<<@ bd@ -@`tpLcL00 1 111 1 e0100SU0 pR3J`QU1P0@01Yx0ShhPP0P00@000S0OJ@$Kcc|25d d Kc bJcdc$B -L$MP`dpx@P 0 00000 0 000000S Kd -xPLpIh0` AT$Kk JD10D1JID10CD19@ꘛdcB -0L@0Sژ00SsPI0pa101<181@1I/,$Kk'0 A KcKc6 -LM`0@S d3/P tpJP$K0$`K0&0匀 PQ I(0S (Ky8 00R0!0ES:< D00C, S:  Ycc -@`Lp]:I ;SQ 0@ 80S P0+`0P0hI IP0 0CP0 [IW@0T   dc -L -QL@H` pD1S5 0R 0tP10 pm -I1H00%IPU Q 00pQ 00i=U <VH$Kka ꘛdc@d 0-@LK0hd`d /i -LMp`@6P᐀0p00 R BT1 0( 0 `p`<( K Q!`0( K3P b -p0LP@@p T0 0 1`က0p00 R * @p @P@$Kk \!1: mP b -1`0L@S 0P V00S 0`VP000p  %BPW 0 R   0T0T0T00S W40 00R0S00Kh/db0c  -LG 0 d0c00S/G0cd00S/&H0cd -`DPLGl@@ 2 @T oR2@H@Mc 0-@PL00GK0h`R@Mc 0-L 0@ 0d -LLM0RX H0 0A?o20Sp0 0p00T P d0 0l0 \0 X0%PPpp!P `0X0 H0L `p X  cXX U0X /*X $ X #X X ,KH0 i0t\00\0 T0SZ d0P Z0#03R0SX00X0 P T-X .X +XpDX 9XX ` `0H✀ ` 0H PUXt XXM OX`A 00 H @0poX iX dX hX@`lXm nX jX`tXo qXj :sX 49YH L0s:   ᘢP@7 L0 @@S0L0 0xXO zXQ uX{ - 00 H @0(l @ 00 H @p0 0`0W pN`L 0S`0 0F0c`0 0`AXX  *XX 0PL 4 L ,L 0H P.L k&X  lRX ` X  `llp 0,K@0i0H L0 L0T0Wh0 0 h00h0 ` \0hR00\0 70t0 0 PC/ WE T0S=Z0t0 S0p`0h PCU\0PL0@DTmL0@ T P`0h @CTT0SZ d0P Z0#03R0SP@D`) 00 H @T00-p@tPL Lrk   Q R-K S S- K-Kl 00%"0i$2>@P0   H @_   H @@HDH 0H  \g  \  b  @\  X, H H      0H0 @H  @@  @P @\4H Pl0 `0px L @p,`|H @, H   p00H  H   P@0o@p @P#   H @    H @@ P 0P@00B0B0S00S000IB-0K 0CL@L0  0!h00  C 0@Ph h0U TC0@@C-0Kh0 T0SZ d0P Z0#03R0S 00PEUP T d0P Z0#03R0SpP T T0SZ P0d ?o2Z ! 3R 0  dQ0SP T0P T T0S Z d0P Z0#03R0SpPEP T0T0S Z d0P Z0#03R0SP@D~P T0T0SZ d0P Z0#03R0S00kP TmP T hzp0SP0 003/\(K:$B@$@0c --LM0@ @@ 000S@ @ Kd --LML0141l  2 0S 000  0 K b --LML0141l  2 0S 000  0 K b --LM00 0 0 K p-L MP@`]0` Kph\ --L M  K --LM  K --LM  K --LM  K  -L00S Khgd --L M00 ~ KA p-@PLM` K`"007TU 0P0F%07Kp -LPp\1 0S PA1S  8fPT !T,21,240040@0S10 0SA000 R 0 0Q000S`0 Pu`r0S X0X 0Q01:Hcjb bdd0cdda0i$BdJ}A@A$B --LM -- LM0 0 j K -LlMpP <1l!lKm@KP >(K 00 W00S/ Q0S+ j)@T`@ T @@|K⯜t0Z#Z  0 Ԟ0 ;Q 00lK 0@'K@ l @T00 W D0   㳞0 `@0cq$B 0-LD D@18 00" ~K0hd @ t 0-@LK0h --@LM0@ @@ 000S@ @ Kd0Q  $B$B p-`LM@P 0P 000S   Kpd -0-LM@P@P0 0 00K0 0S <P P@ 0-`LMp@  Pk0 NK 0--LM00 00 K p-L Md0@0P` 9T 0@ 00` kKph0Kp|XdA --LM  K --L M00   K --L M  K -LMPx0`0p@@U 0P D0 p$$00SKh,K|XdAd --LM  K --L M00 3  K --L M  K p-L Mh0@0P8S`T 0@ 0J0` KphKp|XdA --LM  K --L M00   K --L M  K -L M00`pP PP[0X @   0 X0 H0 pJ0S Ki K|XddA$B --LM  K --L M00   K --L M  K -LM0P0`p@ @@U 0P D0 p3$00SKh;K|XdAd --LM  K --L M00 B  K --L M  K - @LPT4qT`@0@<@@01 010101 -4QL`<@p1S𨝈!0A! 880R𨝘P@ $1 q0$1,20,2 0d!Khm@ -LMpRP 4a@b@p0  <0Q!PE!( R@$KQP@ &KYP B@2[ p&KrK[P 0-d@P0ML@PD00P00 P 0P@ 0 00 K0ac$BA 0-L/@ 000 0-@L :8K0h - 1LP`V00S @P@0@100 _S ?`D00D0P0DP01@V0 tI0l y? yP` ( `p`@@?00dKccc bacKc$B|25\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -TAL0S` h?81PpU @`V 0S7$Kk? P  0R00 `000PPP P  0R0D0 P000```Q   00C0ac bbc// -X`P𝤀0 !`!800 (  , ! b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -L@P`P@0S@ 0-@LP000/ -LP`@ >AP 0-@L6>nK0h00/ -@LPpm``00(0@p!0 `Khz b -LP@`SpF0S00 R  D`0SKh0 -@LPp1`$00@00 0!0 #Kh= b 0-P@`pLM00(@ $P Q 0K ( K% 0[S0K> O>(KGKcp27*/0 1\S/ / 0-L @=000 -Lq$B -@RLpp= 0SPP!R PP Q `a E 0 00 0q=P`57 -P`L=0S@ p Kh=0V* @T 0A 0-@L@ =0 -PL`=@T00=P0 pS   0S=Kh bP -`PL@^=P 0S @@=P/0S / -L M`P00 ==@pT 0 S00A0(Koq=o=+=@Y:h=0140 >@=@T R 00A0Q=O= 4(Ko) R !~00q0 R    0=.=T(K%B -@T0L"T0!`|0T t0p0A`c PP0puP,0A#cxb@B|b -L$M,@K<Kc#KKP`p$04 bK0CS$0 P=9K =$0 KШ -LM !K: K K -L$M,@K<K3K"K R0`p$4bKAQ$  R0"K00$0 KШʚ; -L$M,@K<KݕK"K R0`p$4bKAQ$  R0"K00$0 KШʚ;0@-\0 R@T0000R0S $00R000<0?Bxb0@-d0 R@T0000R0S (00 R00<0ɚ;xb 0-LP@P@ၕ0 p-@PLM4`Kv 0 0 0St   #KP0, 0CS0P,   7 Kpɚ;6eʚ; -LM' RB;T214aV;`F`/#KO<Ѐ;1 0000`P7 (KbO taB14Q ;T1 +0S X`@p`; A ?!?@!`VPpWV 0 `#K 0`p0 WV`lWVϠ !`0T !P PwᗔK7A@Mc b|bʚ;@B p-@PLM4`Kb 0 0| 0Sl   #KP0, 0CS0P$    Kpɚ;6eʚ; -LM`@VPX 4`K'pP"X P0 0CS0PP   pP  00SꐢdHcd - `LPp6뤀夐X0SG \@0S   0 X00CX0?6;6P 506 0  k}5p=d!%B 0-@1L0 0h 1 Rh  h 00 -LPp`@P `P 0p00 0p500h00h0@h@0S0`h``@! !5 0-@L45 1(S$!$!$1 ! 5K0h ꐢd/ -Lh40 0000S 0 ,0Kp# 000pW 0S%h0 000000S 0 ,0Kp# 000pT0S8 0S50Y1h 8 008 ,KS@(0  00S 0  10p 0C13T0 `3/0Q@(K0W @|30S   0 -(0^ : 0!3201 =T0 0(HcT 0  -LM} K -L4M⬓@0`X@ 40 P)s B03 ,3 (34000 #0#K8#L.#\x00s#K ?X NŸ#0400T01*@P[   20 L00X0\0C?00 w0EU0 *`P@e Vp `!0K$ P0 0T00Qp`0qq(a  2 ,12017S3410p6U EB&VoU, 0d0h l RR0 ߦ 40 SI 04 @]PB 7@(KQL 0C(p ypE@PP00!& 0 0< @WF0 Q << QPr`F PpPЂ00 'Lf2(0@, ,@80R !$$12Hcdd)%B\7`7.%Bdtc -@`z0 ML00P 00 0`0@pN0 00  0x0`@0p0d\0 (X00L0 `0@000#K _7d[75%B1|1=%BHcG%B -L M 0  K -L Mƌ 0  K Q-L Q Q1CVN%B 0-0ML000@ 0|A00c00*PP  XX=R @<0 0 !K0hi@dS7X%BD@d%BDR7|b(0(0 C#' 00/Tb Kc00 Q,0$  B'##  / bTb -@PLMp `b10  00 0 0?PV 0  \ PX0  PP D1 K$ 0  P 0  Bti7J}A -@L`11|0 P1R p0S 0S $ R$0a1S 0S0$`P b 0-P@L1 PE1 -0L`1 n@p00S 0 0 0-1PU00P0$0S 1y03/P b 0-@L<K0hQ0 b p-0L MQP0 ( 0@S 0 0K # `00T 0S 00; Kp2 b0h0 ``0(0K00`00^pP y< ,L0S M,1( (`LP,`P+0U 0((0?0t0=Z(04, 2,/,&B &B bx7 -LDM828p0 0S#@2@ 1lK 4QE@PL0?SXP0SU d0SP `0SMX X@T T> T@(KL@TZ +$0S2+W6 0<0 $080 0@ lKL`40 jF@P P@ lK0HTp+吙0P 0R:将+H RL0+@L0SP L@(0WP0(0P 0LP(P0 0000 +Wdc bd b ^ -LMPU"0U2 00S#p(K4L0S L`0Y@0 Y pbP  5 0 P) DpP0?S0SQ 0 DpP *00CS0@1+T ,0 00 4  80 <0 804 pPR*ZpY0SWp 'pWppcdd -L $  0  0 0,p(`P}P 0!0 $0'> 0 0 0,p(` P}P (KHhuP (Kodc&B&B r7 ,&Bcs76&BE&Br7X@ RR  :/ -LLMt 4!LPU# SB 0p0 ?cpz'࿅ ?`1R@00/㴜@Tp0 S00Y0S#`'#`p/0ᛜ@)pt0W  `P *(K0@!R 0S H0R $0S*@ lKrC`P<0S )pHR L0@B|b -LMPU%ژ00U!Pq `IC@P0 S40Kj@ 4K8C@P $K#@c p-L MP`KP @ 0 K@ 00Kp -LP@`4pP P" W)00000)l0141@00ST*L00T *UP  wPQ0@ P bdb -LM  K -LM 0 K -LM`P @ ( R @$K!pR @ 0 Z!4A, Z Z1! BR-@ 0 PP!R R R   @ `  (`  ` )0 P;@@P @0@ b -LM`P0Fp S,77777X P(K~P P P10 KJBPP KqVPP KUCP[@P V@ 0 P 0s0 FxWK W(  BPP Y    >  x P 5/PP  >   CP 00V񟗤Č747L777Ў77777777h7t704@S\*820\:Pp0 K ,P001 100  P#000 S )PP@ 00C p1,`K 00& 0 03/PP0  "  0, K0" 0 03/pP 0 03/Pk 0@ @0, K0" 0 03/pP 0  000 0 3/ x00 0 0I 0 K\ 03/0P0, K<0" 0 03/P6P4db~f}f3{f@|f 0-@L^P p0 0 0-L@PO0P @ 003/@!0 -LM@KP K+BK -PL@`+P @ (00CSꌐ7l7l77-@0S<@0 @ @ -L M@P @ (0S -@K0 `1K0#K"K0S S S 2K> 000 040Kp rKN 0 040Kg@0@ -LM@0 ` T0i P 0R0b 0 #KP @ (0S 0CS@3-@# 10FS 0t00S r@(KV긒77777ؒ7@@4 &4,`&@CK@T P@ 0`@p0|`| @` PpVCK@P 000V 00S@ &0@0 09@ -LM0@0! wK -L M@ KCjP0000K 0-LM@P K3jP KAPK0 -L0MpD D K<  P8 0U`141@P ,P D0( @$0 ! 0 @< K04/@P,  R tT00#T0S@D0PE0S @0 Lg 0PK bld p-LM@P`P 0 0` Kp -L|MR @8 PP 0 @.Y (0St0S 00 M@P0qlX X@0` 0 d?@P0 V  Y(Kl0K`0 \0 刀 x | 4Dt X141 0 R8|0 0 0 @ K04/@P|0 R tT  #T R@ X0B 0  R @  f|| PQ 0fP m ˙@@ bld -0ML0 0O K -L0MPH0 L0KD0 0a@0 00 1U41pD0L 4P ,0 @2 0 @D K04/@P 40S tT00#T0S@  T  0lp%1 43]<%40PED00S @0 .f 0P$K b@Mcld p-LM@P`P 0 0` Kp -L|MR @8 PP 0k @.Y (0St0S 00 .@P0qlX X@0` 0 E>@P0 V :(Kl0K 0` x 0 !刀  4!D t | X>h10SF 0  @ K0|4/@P |0Z tT00#T0S@ T  0 PM$0 14\$|0 X0J0 R @ weU|| PQ 0eeP ? ᝘@@ bld@Mc -0ML0 0? K -LM41P0 P `- @@ @f0`0S 0 d00~0 S @j~ 0 0X@~ `F`D0S\f oAPAVAM&BrdAg~ld}f~f -  @00RPLP8p a0+ BPP'X  T P"@0` APPPP @`0  XP 7V  ]@d -LLMPS\77l777 LK w<PPLKP(K0 LK APPLKo LK `<PP4!PP04!@`P^X@ CpWX0[3pWX0a3`0 d pd@h X\3XQH@LpT0P0  T 1 #XKP ==PP0p@D?oT20S `0S 1 !dP +=PP0p@D?oT20S V 1 !hP =P`djhgU`0` ` LKH` =|0X0 0P ``p0X0 0P |``p0 l0 fl0 R<  p00,($@@ @t0 0 0!1 0'>0,0($@@ @s0 0 0!@1 0'>0,0($@@ @s 0 0 0!0 0'>0,0($@@ @s 0!0p 0'>0,0($@ p@ @spjk`P  TT `&BTbdcdc d&B&B&Bc&B&B&B&B@7A QA 0 dc -@PLBoPPVP *0 T zKh R00  -`0PL1p4a00CS@ @0$N@ T P{ b -L M@` 0p >PP  Kh@P` PP0 `P  `0P1S!!1! PU 02 0  0  T  dc -L@P`QP (0S & U 0 @i@ -LMp`P4 K@P K 0K9@P00S,00C>S@04PS@ 0S@ 0Kx⺓410w 0-LM@( KP (P $K⣓b $K9K0 -LM@ ,K8`P0 K,p`P00PS  ,K 000 09Q  ,K9`K -L$M41@ 80 p0` =PP 4K0KPP80P@Ό3 Py@P4 08b0 (  ,< b R 4!W8 @  RR R0R Pz@ H.@+0j/ 0R0: T8 0W`0% $1 0 0@0!1 000ru1@@0 f@0pP< @  P ,u@1 0$0?(0L00 0000P0 00x04 8p404  T' (K g Pb< R@`P[vowrτn0pSk/1@!@<K`@PCV,c @&B&Bo dcdc p-LMP@ ` P  ,K7P,KAKp -LM4 Kp@R`PO4nw4P(0 Sr,0SH 4@T! 0b0?o0c 0A P00 R4 01S1 B"!,00C,0U4 T 4 NV 0  _800P0S`   T8`^(K !T 00K zP `@0@ 040 2 0 0P"  #P<#(` -LM0K000@jP00K 0-L M@PP  $K6P$K(0K RP(00K0 -LM3P `R`0U S: Y 5@ 6`P (K2 YP K {`PrvU(`? p(0U, $0RJXj  0hh! @ 1@1ᨁ, 娀RfPU 02`x RP x K0 | 0  | 0,00,0j A0  cVU (A KT 0S 0K P `P00  P 0 #P<# 0S0000@@ P0P(`(`\ 0  @@cdc@Mc -0ML0( K -LM@P  $K5P$KK 0-PL@;0S0xu -p0La4A$1X03/X0hPPUHp"h00 Kh] P!KhgU b@McdYd -L(M`Pp4AZP ` 1 ` 000h00(0K000000@01`P L$K(0P10 (( $0pt0S d0S0(000C0y 0(0 J( 0P@7 -LMp4Q`п$1@T _5PP#0P (>PP 00 , 0>0 K 0 40K( PP 4KV6P K᣿ -LP10/20/ -4QLp i `P @W0S $0   @_ @P$  P P $0$@@G( R H v@@ 0-P4AL (q PP c0 \0 0-@4QL Z @P L@0$0$$ ( R @ =@ @ p-L M@P4a 0 Kj@ TQ  K5@Kp -LxM@p?T`@#4Qx K00 x0@ t0 0``p $0  $ P@ T KP@ K@Mc -@4aLP P1S@T (0S HQU000H15H1(0S  4 P1S 8ATP$ P -0P1L4A0!!`pp[Q  T PP  41SP1S  T0RA {$02$0Wo bdc -PL,M`RpH PP U0<0K0 @0KH@P (K@` 0젟刁4!p''D@@ $ 4L0  $$  9%@  L0x d0p0W@Wp@ #PU  L<@@U < KH bd'Bc p-LM@P  ,Kw3`P,PK KpP P0 `Q 0 x49`P 4 -LMp@W;0 P0E Sp#*QU4`K᫽` ;3pP 0KV ᠽ(K @1@$$D@  0 @ l00 0 S 000S   Y 0P 0 0t QP  F4!RP!R 0$ "$ Vdc -p@WPqLF0P $8@P ?T014a _ pP  Q-@(TATQ @T @ b p-LM0`P1VPa4A 2 `P $KpTQ,K  ,K]  0R #,K7 b -L M0@0KH P K3K -p@WL`@" 4DP $@F0SD 000 T |@P0S W@/ Q 0CSr// 0-PL@t0S0 0-@p`@ML! $PK@%(00p,`$@ @@ @ k(0S) 0 00!0 00000'>,p0(`0$@ @k 0!T0,p(`0H0$@ @00 @00 k$K'Bd 7'B7A -LM@pi 10 ` P㬀嬐0 U:DSTP U 12@Pmi$K0P1S 04Kw+4K\'BKcd#'B -pLMPK8a` @M0K\0 0 0 0P@ 0 0000 0c?oP20SP@-0SP)3iPUP# ƻp`U*0!R0W D ᯻P$ ᨻPi(KdKc40 P0@1S //d -@Ljt01@TP 0S $ R$PDp0| 000Hl0`0V@?04 a00C0z V R0(aKc bd@McLc 0-@0@@L P 3>  K0hXbd`7A -0ML00` PP@.@ 0R p0 S  2 @ ^ \P0p80KP  1@P cKdKc -0 ML000@ PKhKK -LM0@0000 0 PPa0 $R8P 8 80SP(K0ST `P0t00 " t!@S T $ 0 P` PanpW@@耟T$Q  0K)1P R P 80P TP(q 08 S ,2E(AKc b@McLc@ -LM0 P00`p0P@"0S U@P080  !1E !000D Q4! Q @.@`9(KuP11Ps@ x@sx@P @t a P@ `@@` @80S 0QE0!000Y P! R ; P0 Dj8aV X Q  0Kn0@Kcd b@Mc -`D0LAh1P\ATKhpp`@ b 00-L8M000T ,00 H (0@  0 P'.$0 A0 0 hK0dc)'B -LDM`0Td SH T A,0S 0h@0 d0S0H0l1pal10\0 \ H00`0 0X0 P0\Q`QX1 0h0 d0S pH0`T0S{ 0PB<K pPS\ `As``H0LP P0 %P0 D P0 D0PcP_oPeu T  0R;X 20S0 21h1P06` T P0 RT"pR 0L  00SM PEX1S 0`!00 00S uP #UP(K UD  D l0 Pe 1l0d1  2/PL l0 L epFP0P 8!F!dV 003/QY FP`f 0S <K0PX0 p`@ 0h S @AX1S@S 0X10Pl0p0X @0 RX'RPP | Pw b\@dch@c0'B -LMQ 0i11 210Qpp0>0B20 A0R `KR`Z R  -0PBYP M  -0P9XP H -0P00 0 00000  P R0  .0  S R 0  .0  S R 0 S#.0 KV 0 0(K   b p-L4M@P`  <Kw-PSp`H0  ,0K #V4A@0  ?UHEVS yD0S DKtE(K0S0S`0  T3 0Sh7777l3 0S 2  l0@P\0U4 UD UF 101 101 101 10 10R 101 6EP $04$0! 101 101 101 101 0Rc -L M`4Q@P 0R< KS,0Kp W Q  ,Ks*p <KU)pP K -P@4aL r@ DH  L!0 0 Kh -@LM$K $KC*K -4a@L Pl0΄t1vx0 !! !! ! 101DP %$04$0 KhRc 0-@4QL <t1S DP  $04$0o K0hkt΄vO Q0-L @0 VP 0+(B 0-LMP@PQ$KK0 $K(P -`4qL@ PV 0! ! ! U` 0` 1 ` 0 S `3:0 ! !01  0-LMP@P Q,KR KP Q K) ,Ke(P K0 -LMp `WP4 F K03/@PKs@PKpP-K0p0SppK h^ 9/@Px2x!K夐K x!|! |!! ! 101` ㍂ i 0 NBP Qs0 0lKx 0  BPW #@[ꔑ41b1S41g/!04a1 S1S PW Y011S!!1! hW4 yWY1Kg,K KP`p0 kK0CS0 P  K +K KP`p0 mK0CS0 Pp  K -KR0 K 03/Y @ (K` K03/P@ Rcʚ; -0LM( KL  0-PL@ 0S0 p-@`L MP Kȯ @P 00  Kp Q0-LP@ Q Q006P000P h0T @DTt0 R0 -LMPrx0 0 0Sk0@ShP Aq tPP 0(K e `0 0@114Q W @T0 00S P10 S;xy php00W0S j0 00 { Z000x` h0Wt` S` t`W`F?0`p 0P 00 I00t0hpV 003/<8A0@Mc b -L M@ K &P0KrK -LMpJ@P` 0004! `P 41 % $K tPh41  0ISPEXWP -L M@0K KP  K'PQ  K'K -LM0 ,K (0 PP'A ,6Pg $0S(40%pT` 0S" A `P Pd ,P (KЮ(P $K { `0 P4a o 000 NPP@ Y P1 S(0S 8AT XPP (K⓮,P ,00fp(K,倮0,0 bKc@Mc -LMp P K `@Px`P@ @@04! P 41@ R  YK7 Q .41 @   a@o -`LP@v0S@ @S0C@|``0 V|0s0C0@?Vt0`S ʄ0h@0T0 |0V|`ŀ`@@ -LT 0-@p` L!DML!@1,PK 000p,`($@ @@ @@% _ 0!00p,`0<(0$@0 @@ @ ^00S! 0!0 00,p(`$@ @@ @d^? 0!\0,p(`0$@ @@ @0  ^ $$$(K A'BdG'BM'BU'B7A -L M0004A4/K -LM(0100000A4/K b 0-@PL0 0S0K0hxJ E 0-P@LP AP0@ 0-P@L 190 00,03/PD 0 0-<2LPQ@x )>C 0CQs 0CQZ 0Q0 !40iS 01 0(011K0h/1Q\ 0QT 2=C 0CQ0051Q( 0CQ 0Q0!S0 0 0!!01Q 1[?CQ2 1CQ TK0h:g0S1::1 P0Z0S: R*0RS0C BS00 TK0hG1#30<RP wt@ c bs@~fvt -dLPP@`^ 0  B?" 1R@0@P1B @@V d 0-@PPL@> $1S0$1  R  K0hr 0d 0-@PPL@& 1S01  R  K0hZ 0dQ0 !88S0 00C0C0CQ0C 0C3+C? R0/ -pLM`KP` @j~0K\0 0`@0 0 0 0000 0U?oP20S(KcQ0= S// --LM0 0 00  KKA\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -L1LP@ `p0`00T1x\PTPRP U T1 c```f x `F Ɵ0000``U@ `p0`00T11 !c0 ? R1 8 8 8 8 8 8 8 U PT `p0`0x P  U  c?0SxPS0C°0L!B00000d:A@ 0-0L@ T15T1T!"20# P00 0@P U 0@SK0hNU^IU@? 0-P@L@T08; 85 0-L@P 0S S 0@0\H0P40(0@0I_00蘍@d@  - LV}踍@ -|1LS 3/ 0-@,PLt0<0K0hd 0- 1L@Rʘ$Ie0 p-L M@^P c @` KPP` K PP0 :0c?N Kp E K = K -L MP1T@0S 5T1coR \ KB/E BRC00C08!P ? RnR @  \ 5p*T1 >0(K0PPT15T10:0PpPGUPPUJM(( Kd [ 0 :0\:@d'B0s/S/ -pQL@ Oc`KcA!P"R ?0~0B!?0 S?0~0B?0S0? ~0B0Q?01 -PLM Kt Kp Klj`V KK~K|` KxKp@@\Kx@KKK@pKx@txKM\KK@KId -@`pLX"0n@P@00 ]:{P$W 00S dc -LM00@Tp @T @TPS& 0 S* Q` 0S`  ^P``  0S @|PUY H03zd2 `kexb Z 0" KN K~KT ] `x0" 0?0K= KmK TPUZ0 KK`P' 2N- R +K1 K00 N=0S0 *K1 K00  t0 R^ 0CS[D00846#5d0bl b0T0bH!d0K KK(KaO ^ Q|Qz Px  B Y(0S S! 0d K L0 K J80P J0`c8Q|0d dL0K0S 0'BDId'B'B6B?BH'(B'B'B(BAA}$BKA -jLP@`0P1B @ U qnc@V%d 0-gOQLP <0 8UMP00S0\ d((B -`L@PV 0P @R00PU(` 0 P1B 0 0000PP0C00 Pd -a L0R@PLpŘ PU 0 PP0S|b -P`(@LiPd 0-LP@P0 0cO00KA -LMA̡FD@ @T0}(K p1PcP_o Pu0a0?o0cP$ !P E12 1"!10CS1!1R!101! U؏ OW( :W* pW 0Ta0`0 80 KpKX  n=X  Y P  =@Mccd 0- L#P -`L|M@p1XS 0 0P!B @  (K0< #" (6204"Ql0 R T! o:P2 0Sl00`0`H20 v <0m2Z 0 S2V dQp1dp# KP`pKPVML1c( ?0!oH0V"0P}대0H0 T1p`F0 Sn*0 S5dd0  x 0 T0C0p`F00  0 0P00T10 Sy>0VQr T1 0>0<A Dd b@Mc|b@ 0-H@PL00,0   PP000K0hdc 0-@DPL000C0 0R 00 K0hdc 0-Lͧ@PJn n0 (946 @`/l, x%"/ 0. 3I101111111111110 8c1(B8(B@(BG(BO(BV(B 0-Q@L][01111111111111S !1R 101! P%nm^ Q@OxM(4`l IK0h<@Mcdc -bLML  /B  0@Pp;!\2,K@(,0 00p(P$@ @@ @P\V0 0 0,!1 004p0P(P$@@ @GV;0,00 0 0!10 004p(P$@@ @1V000;0,0 0 0 0!P1 004p(P$@@ @V;0 ,00! 1(` `0 04p0(P$@@ @V 0`!0 0<0K0p,`(P$@ @@ @P0K0@ U0 00!p00h0,p0'>(`0$@ @80K< K0KU(Kd@8H8fA^(Be(Bi(Bn(Bt(B&XBc8z(B B 1,/011 S!10 !u0Bcd 0-@PLX80U00 00P1B  j0fPd 0-@L$ "0  (K0h 0-L@P TQ @Q  c? > 0>;000<02Q xa$IK0h 0-@Lpl0 R  g/0@000P000U 0_ 0db@Mc -PL`p 0R@ @P1B  |AT 4/0 #P@P d 0-D0LP#PP@ ~l 0|bd 0-L@ $m[0d -L MTa@ P<00 & " 0 "\00\0! 0!Hq4 00$0S P % (K" 0 "$00$0 R P @   Z <0SP  P14 0 TS 0000?Y$0!T1  T0SH1  eP xP000MP1 1S 3/P0000  〠  90 7 f1 C/oS" R   ^-*090 g1 C/oS" R T15  0T s .T15T1(Ko3 `1 S  S Ra1 S  S R V\ }`1 PC_oSRPU  Wb1 S  S R V@ a  - e1 S  S R 0<0၏d!0B?o2 RPPU  d!e1Rd1 C/oS" R T15T10<0 Z   < S[1 S  S R 0S 0  Z@ ]1 C/oS" R# c 0 R P    Q 000S0>;) K \1 C/oS" RP ^1 CoSQ1 ` P P p p0 P P "l@wp0 P P V  @ X j1 C/oS" R !T 00 S   1Rpl^h  ^Pb<S? sY Zc X1 S Y1 S Z1 S+ ) Z' 0 0@[$0  :0/ OX1 PC_oSRPU. , P PEUP#U& PE0 S > d@ -PAL`KP @Ld -L$MT10K2T10@9000 000K# P090K 0-T1L@ T1T 00h1S0i1S0 -`LPA@ @p 1R@ 0P1B @ T Q W@ IPd -TL@P`8U"R0d -LDM0@ST d `(K0 `#K4t4 1` 4lT1P0  ^2 Q-l * S' L4;4Pl02 0S`TE 6=3f`xV P0<X0 yiQ0\0 Uh!01RF0P -h \l0 R PPl00A Y0S;H1  dP x P000P1) 1S& 3/P000RP5 SRZ<KW0U`0 P  Y0`,P!B )@' @V` R LKWK 2d$K R D 40@tYqY0EPSZT0S@0\0 ڈ0*X0S d0  #`%0 (`h1S#V V#V% icQQP h  R P0 $P0Sa 0`P[XX 0Q0R0Q00SMT9`bVCT00S? X0S U: X1S Y1S Z1SP0  U,0`# bd@Mc|b -LMp.@QP4! ( BQ*(B BQ F"B(BQ  B%- R#-Q  B-QJ  =!4"\w d N `-Q gl BQ: Q U 0-U $-U -U =U" 0CU 0U %40WSVS*KS  3< `V  WΡ!CV  $`  06/d,`⿡vOH @< `V  W⭡!"V $`  06/+`➡/+Q ++ Rrl R " R} l zj2Putk8  5 wD+`PZ (K;U# 0U}`*U   BU :Uo V0T! p %`8Ue 0U`H(V0p TS 0H0HS`* ePP `% 0D 0 0 P 妺 Kj`Pu ne'U 7U0CU6*0CU017,7U 1U 7U]_h 5vP  o y60Sl70S `P6UTH6@0 1Ss 3/`Pn 1HM+00H&0 0C 0;<PUPP3">`EdV@T`&0 =00S00c060U" Ql0 0S00T" Rl0$0`btP19P1\0;0P1$0l1(0p1(0S ] 4U T1"    2T10VH10L1T1  0;; 0T1 20T1 o`@P K`KT12T100bP7 忻`P 4 " Rl  000 R0(03/spO0l<0ᏉgRD<B" R   QR| P sq`P " " " @l  l `&Q` R Rl  Vf`PI`Pb@``v HQ" Ql  `P 2 0R`P0 KKqK`P\0S H`cS} vS:`:W `JPtttd butBt @xf@_t t (B?c(BEcCt gt@Mc|bGt ot nt ct@t@wt@jt@t@ht@ett,@|f}f\t`tbwAvtmtptt, 0-P@LU0  @  P1B  c0000FPdX/X!/ 0-H1L@ , e1PSPSPU 0\ P0<0P 03/d1 S S R 0<0|1S /|13/ l#Pd/ 0-P00L@T0lP @(c/ 0-@LP D0@PP  80P00S 00 0:0d,c 0-LPPL0@T 0S 408 CTT 00 0 0@d(cdc 0-@PL0,(0 8 TT 00C 0K0hd,c -L@iP2pP( kP`000 @R 0P煁Q 00<00S  R  0P`?d(c@ ,-LPP ,c(Bdc(B 0-@LXkT08 CTT 0S 000S   0ddc/,c-D D !|!R  0/c-D D !|!R 4 0/c0 6001/c -P\0\`L 6L001@0003/000|Q?dc |00- 6l0@ 0LR1 R 0@ PH P040(0@0,P c0@d@@ -PtL`P@@@ 0T@ 0 T@X ?"@    BQ T@T1 WX  Bd 0-@PPL@,0S0,0  R  K0h0d -PtLP`0@@! R  @ P0S@ Q@T 0" PP QQ  0"@0 0@9 0Wd 0-@PPL@G0S00  R  K0h{0d 0-0L@ 0 L0"6 0< $0000H0&K0h薻c -`Q` 0LP"6 0p A00000P00P0 ,$4v$Khlc -LlM0pS@% 1!0 &Q`@@,   PY 0P0  @P@  ,Q,#R((K QY 0<Q0 @0S  @ X; @P   h@T"0@@ @PdRd #Kx@P K@xT0@@?o 2R0S@#@cd -L|MP @ `0 2r 6t2010 x00 K @c 0 x TX\ R TP @- `ⰺs tTdRd #@AT@!h K Pe  @0@@T`K H P@%@TdR@1d@#C Kh P@ @ `KT!T"$L\ P  (a  0  0Y#@@  ( 2/@T R4+  Ro 0@@(Kdc -p`@1L 6010Q(A@ 0@ @ R  0 P R0@ Q0S@ 0@ 0T 0?o2 AP0RT1#400S@ 0@ T Q XX@ ,Rcd 0-h0PQL0A TQT 0S|A@OoBU0@T@cd -AL`Q3PUhh倲VUP pqA00SSPX4 R p!i0PPE  0XTp , <l0QU T) T0qc(B7!Bd -@0L F@pPP x0x0a@|1S XPH0@|1p0003/T1;T1PUcdP8 Q0-L@0P0$0S@@0cd 0-@L $|T@ ម00dc -Pn@WVLl0 h&60` ae $hڸ ,$`4Ҹ Khdc -\A0L F@P`pP80>,101@0@%P`1H10L10T1KST1S0 00.@00T1  0 1W 0CW15':P0@0P00W d0CW H1< e1Sd100C?o2 @ S> P0@ 0 0P0 4X00SS-P0@ 00P0c`t4Z8it_t f@u t tptdut\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -P@`LV` UB 00 0P 0-@LP P 0SB0000 0-@L0SP  \P 00BSs 00lRQ3\000 0S00000CS0000 -LP`bpV0SS 00sGT @@DV@ f0`Fp0C00@ 0@T00 -PL`8\ @ V@@DT @@DH0L0A0 @ l@^ 0LS0SࠡpspphR^  @R  LR  0-@PL0S0000K0h 0  S 0C 0AU0 BPE0S00 0U RR   -@L`0 PSS 0Sά P0000`\ 0BSs00aR! 3 C<  !0 0000S000)B -L M`Qp@Jڄ0 0 SA S0S4 000 0R5P 0PPC PE0UP e R  C0ࡁH P ⬑:50C0`Fp000P 0PU00VpT uP 0X(KN 10c00Z 00)B-0S000SQ0CS0 0S^ 00ASs00nRP3̌d-0h S0 0 ^  0CSs00nR\3, d 0-@L RP @Q  BA0 \P 0CSs 00lRQ3\R  0 0-@PLp040141l 20 P / b0-P4@l  P00Ř -`h0P1L41l  20 @T 80 1PtP b -`h0P1L41l  20 @T 8Ӎ0 PSP b 0-L0P41l  20 @T 0ᴍ gP50P 0-L (4l!  P | Q  Qh@F4!200R0l@l@{0K0h@@at @Mc -P)Bb0S/☖cp8 -xPL@h`pW V0`D 0 P@?`aP6pcd 0-LM`0!@0P,EK~bHAEK^Q AK^,EK%K0 -1L@/ H1S,P1:1(1<`S 1(Q,Q:11 01b)PHaPU 0S 3/P > ;0$H1EI -PLM@sU 0SPK,GK.&PP GK QKPK)pPP 0`S 1[S GKH^1 H1S0Sp1Ha:1CK3/PV P ߑ ܑ$HP 0-L@L(PQXNX0$ ^X0 K0hWXdw8w8 0-h LP00P0X0@TL0LK0hQXP0SX@$0S 3/,Pdc|b8d 0-l LT00T0\0@TP0I4K0h.XP0SX@ 0S 3/,Pdc|b -LM" Q"  "  R P㴒@P 0" 2 >@`P> P(Kp42@22 T 00S, (0S)PU& 1"R" 0"00R000 05Pd2Y00X0Sz  " 00"S? @00090S00  0`0.114 - Ka 2S 嬢  R " @ " " " !t " l p" h" Q cKd"K K ?a R Q0 WK 5a2KS H L @ D 8 < 00 40 -KkP᳸Z000 U 2 I =2 0Hs } \!K"[!KP$ጻ2S22|p=;@KcKc b@-Qp@P `| @O?Q`0 @ 00-X00L@ X  $R|01X0S 3/P0ST0 R D 0 08 04 0c000S 3/,Pcddddd -LLM0 0@Ppl!2 000,P(p$@ @@ @P`pz? 0!`2 0040P,P(p$@ @@ @P` f? 0!2 0040,P(p$@ @@ @P`Q?0 000!1 004,P(p$@ @@ @P`xl;00S pPp`ppU:T "(KoP 0"S@ (K萟AdD)BK)BU)B A{8D]B`]Bd$P801X0S(00S/ P X0dc -L0P  0B?oR20S,\ 0P0-L@ P00^0 R\ T\RP\,00 0-L@P @0S K0h/0 0-L@P <0S K0h/0 -LPL -LP Kh@P0ӗ/@ Q0-@!@3PLPP@0 -L0 S L Kh?_(@[)B 0-LP@OP  H0S K0h/K0h -p0LP @6P D0S $Kk/`PV 1 !P @TXePF舀X B BR !KePUP!Vee 0- L@0P0 K0h -`PL@P Kh)/0S% S S  Kh٦S S/0PES@# S S 度S S Khэ0\  Kh Kh Kh:$B)B)B)B)B~)B)B)BJ}A -`pD0L@TP0SX@0S 3/,Pc -`Qd0Lp@T0 R X@P0S0S  3/,Pc808 0S0C1 S1 P #/bJd0@S/  -L M$0 K@&PKd_> -LMP`Kp` @^ 0K\0  BR--00 00 0@` 0 000Oo0 05PB@TQ!0S S S lP0QQT<0P 崠(K80(0媠$00Pbd6@LbHb -opLMOK _]p 0_Kd$02 -` ]0P 0 00000|B lb 0 0@5(Kd8 0-1L@SHP圥L0S0L0 L+WP U0H@0 100K0h聠UH  L00L0H0P D0` pT^ X0\ K0h/B)Bd\ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -LMP0@TP0,"a!,"p @T!,210#,2 00 0K`0SX@(0S 3/,`ODT 0K{0S 3/0KN@BTc bdd 0-LDM!3@`p'0P< ` T0`C` 00 K00000p@fꏏ@{A -0L@p 娜PP: (  0 0  000HLNH0H0@夀T}T`P `  0 0 000HLMH0H0@`TPꚏ@*B 0`( "4`#/ 0QS /P cP0 (/0 R/ -` L@ZT  R@AQVT PPEUP! T`F0@ -L M@P`@V`V 5/||p`-0K  P@-[ 5/V 0D85/ 5/5/5/(K+B AAA@ -L$MpP@~ @R 04/0 (K40K PHL4/3[@d#dhFh!4/V V* 4/0 4/3[#!4//[4/0[4/2[d#dhFh`F!4/V ꈱ8888888ȱ8б8|x4/0[Z/`[V \XTPLHD0K +P(D K4/L0K PL Kz4/<0K  P< K4/H0K PH Kp\hp4/0 `ꨏ@+B@+BX+B+Bo+B+B+B+B+Bw+B,B4,B,B,B,B,B),BC,BdX,Bdm,B,B,B -L MPp`@ @R 04/0 K80K P4/8[4/80[P S8P8P80888@8P8P8P8P8P8H8D4/7[<840,(궏@+B@+B,B,B -B,B,B,B,B+B -LMPp`@a @R 04/0 K$0K hP4/$[4/$0[PS S S S S S4/#[|St Sh ddS\ X5:SP ŏ@+B@+B-B`-B,B,B,-B+BQ-B,B=-B-B-B-Bu-B-B-B-B,B -L,Mp@0@SP0 0P 4/0 (@0K P@D4/4[8p#!4/3[#!4/<4/84/4[!4/3[Q& 4/30[ 4/30[ 4/30[ 4/30[ 4/30[  |4/30[@ l4/3[S\4/X4/3[P#!4/3[8#!4/2[ #!4/4P[%RQPEU"P4/Z ~ 0 Pp `Q Q 4/`PEU P0We:(K0S QS 0@`D0K0VPEC0K4[#!4/QS4/`PEQS4/`PEQ S HKxQ DKtQHD 4/ ` PE |T0 4/T0`PEՏ@+B@+B.B.B-.B=.BM.Bf.B{.B.B.B.B.B.B.B@.B.B.B.B/B/B./BH/B^/B/B -LMPp`@ @R 04/0 K$0K Plp4/2[d#!4/2[L#!4/2[4#!4/0 @+B@+B/B/B/B -LMPp@ @R 04/0 n80K P4/8[P!4/8[4/7[4/3[#!4/3[#!4/3[pd#dhFh)4/V@4/84/  (4/  4/0[4//[:Q1!1X 4/2[#!4/, K4/( K4//0[S S S 0n$K0 #0 *@+B@+B/B/B0B0B.0B;0BL0Bh0B0B0B0B0B@9B0Bd1B1B -L4MPp@ @'R (04/0 2`L0K( P4/L[x(P!4/L`4/4[X#!4/F`[@:V<1(0K wPx|4/2[([lT#4X4/([%XQ@ Q QH84/04/,1U6 $1U5  U4/4/1U% WU( 60CU !U4/0 q K0U <U 0U 4/ ([4/|4/0 D4/@+B@+B1B\2B 2B5݆1BWD2B#'2B-2B!!2B+B42Br2B;2BP2Bf2BI2B -LMP`p@@X 0 4/0  $K,0K P4/PY,[h(4/\4/X+[4/+0[ SH$ S< S4 000K P#[ P"448C8S "[4"48#8PeS S4/4/2[#!4/2[#!4/+0[ S St4/eS SSX0 @2B@+B2B2B2B2BMA2B9B2B3BA 3B"3B>3Bb3B -LMPp`@G @ R 0tt4/0 {;,0K OP484/, K( 4/& K 4/2[P#!4/"[4"4 8#8S  S 4/ S S4/0 K4/0 ll4/0 ;P4/0 @+B@+Bdw3B3B3B+B݆d3B3B3BI2B -LoP \`P@Q Q Q l4/0 KhQ $Q Kh] Kh" Kh Kh3B/-/-/-//-/-/-/ 0-@L -0 -L S-P1P!L` Up@F\ U l l  TPU: -L M0p 0`PP)@ T01 0!00000P T D@@ Z 0 0 00P Z J0P@H(K-/-/-/-/-/-/-/-// -L@P` Pą p@00  LX  GM`Wp  =MP -LMQpP` 2Q 1CQP0S P$K09Y@H   80"@KP 0  9 0SژLBT=@ Wq $2WA 1CWZTK@P P K K80(QPUP#W 4PK4US@P PU 5/PH@D@DT KPKK눘0p LB T (1S90001S0:0 M᎘@P00S H@T D@DT@1PT (1T 01T vKfPii -LM`@@@p PP 00 P0 @P l (K -@PLPPU`@ :L`P -Pd0d L0 0AT 0S`0S@$00$0fcec -@PLp K0 <0R) 4 R) *`00@00D0 0(0t`|`p00S0x0$00P0:00`P@@ -@Lp`X4P0@UT  Kh` 0-@LP0 a{000 0- 0L@S 0pS   0P 4F{H?{(K2$01410K0hFecfc b -$0LP0CS`$0@80000?o2@?T vKh覣 0-@LP 0S 80 141R00 !0 b 0-P80L@T 0IP0@ec 0-0SLPp` x!@dwTP胣P (0S X@$00$0@Pec -L M0 KK@P 00S@vT p 4Kɢ@ -LM@ KKP (00 Z K4K 0-LMP KK@P 00 R, R@   R t !4!Q @ 0T 400S K0@~@ b -L M0 KK`@P(0sT@ 0(0,0S ┚K Q-L`P <@ @0P D0P P0-L t>!0Pd00S P!00DP<@̕80 p@A +0$@ecdfc -LDM@P Tc `^Q  @@@@Ah1  oX `P  88n00Q@0 0p@!!(00K0 ,p$@ @@ @( 0!00'>P0K 00,(p$@ P@ @E(x0 00!h0,(p0$@@ @00 KE((Kj`ecfc$@48Ad 4B4Bfc7B -@QL`p= E PP;*P00 /R0S /GPPTy 1DHJy@ d004P(00<$0R@D$&C@P?4Bfc 0-PL@8y0 PP y0 -LM0` KPP   @ KTPKPP 0妕PPp h P0XS    @00C@0$`V80080Vtfcec -L Mp4a ,K3/@P(K4K`@P 04( (00 0X1R 05@$K4Q41@!0R *08 K)@P ( 4@ ,(0Q! 8@!@Ȑ4! 0 'h P0 0! R!@Al80 000  0K03/@P 8480( 0A|@ecdDRSP bfcec -LM00 0} K谘 L -L$MP0@K`4<0 @P0K8K٢@P @K(K080 (00 01R 0ᩢ@,K  03/@P)q@P@KUZ>d+@X1@!0R<*0< K@0 0P @+p @@KT 0 8m<P 0 呔`P `$00$0V@80 P尡l0@!0R:T@0d -LLM\ 00 K` R 00 00Z(8 XP  D ! ""2D0  0 |20|20Sp0p30`0 \0`<0 @P!0DT 4< d.0P 0S (K 00 ?oX20S 9@\0Sa <4 084 0 Qh0 0 XUWS0S80SP00Q0S  E0 B<  F<F @PQ0@40 Z00KT0 00 000 Z0PH01`-T0 dpP06d0 l0SXt H0P 0HP\`:X#: 0L00P  44$040T 00 0C0000 00C00 R0000C0L0S400C40  T0`P0p(0`(`k` rTNXTP O00001D 0R! !X;h 1 0R0 D0 3/D0@S101X1;ö10P00 40XSpXpP X`k40S``@0V`400C40 80S @00 S00R0Sv r804 R00S [%0@TJ0P(@ @@0 1 R804H0 0S3#RQ- ! X  X R% S0!S`hL0 H0p!0@>0pppG 0PP0   H0`0  3@P'6l0 p P4 fX00R0S 0 80S| 00Sy0 0kbV`00400C40 $U@% @@\ 04/H'@x(@v#@t @r0p@p@n8cd_>d I0-L8M ,00@`'~!T1TQ 0L1$@ @ @000(`p$:0 ,00!1 01$@ @ @000(`p$0 ,00!0 00$@ @ @000(`p$ Fh@(d\ P <Ň88$KkL8(d$4B8-4B834Bc=4BC4BL4Bp84A -<0ML0000 $0tP 塇 Kj4BTd8u4B P/P/ -@PL` 0 Q //P00 3/P# -@LP1 P40T aS 01?S0!t4 0003/PPatc1 0 1 000/5/ 000/!  000/9/%/ -1L@P`1 0 Q / 00 8P  0 0Kh/- 0-@Lg1<1K0h p-LlM@` P1@01  d K>, w>0 00S 0403/3KbKp 0-LM@Q1K0hf$0S P 0S 1 < 90S 1 < 9\4H1US ?UK0hK0 -PpL M0@ `PW  P`P/` PPWppW )`(K+`0S 0UC0Q `010@410 01Ç8<41Yx0D1 PP003/`P 101d3L@88(d -L$Map0K8K@ሁQPP!$.2 8@0 I@00  C3400 00(004K 0P 0"mPP 18 04(K400!*!0(08 14^W408 00 bh@ 0-@5L05 00$03/5PP0C8#85?o20S 0j -@L1 ,PU4PU  PU 1P 0003/ 1P0SLc0L1101GPP!8004` 1 1PP  |b Q-LP@ 0 `m@DT0 0Kh/ -@PLp` < p`Khd 0-@0LP l K0h< -0LPS`@  T 1 = ?P -LM 0K#  K -`LMPn 2R 0S 0S  3/@_@ Tp 7 T T 0DS18T T T @T TY q X ]#Fm ἈXm  $03/!@:mT*@' T  T1TC $0CTC 0CT= 0TD1T7 0T4S44040@4C$K0T0CT0CT   T  T 13040 100 4KCzX0 ?#K<00,   @*@Ec |bxb0 -QLC< -L$M3@XpL0P@0  U "U U U U"@K`Vw@0XS1EXPPQn@U  UU~  U<U# U U  UZ ևc X "sl X $0 3/"`glvNVAQ*`> U 7:E 0CSG <K`P0#KR0M4T2ZIL2 "08"@H0 L " 0P07H0L 8(XZ0@ @0 !@0U01 U`*VV 0S 0S  3/P` *P`C(K <K;`V8PU!` 1"U< 1QR0011`@K,`V@Q`Ӿڸ0U U 0CU  \P0;07`P1;10S@0 5@000S@0 5@01`O@Ec?Bxb|b  -@LM,K 0,K,K@,KK -@LP@`(@0 0@S0S  0T 1 ( !P -0LP S@)@P 0SU0` :00 -L M@0 T$KhL 0-@D0LP(0S S h01@0@0H00  X @,X X00H0\0@В@@ -L@P`P`P H0101 $0\000, b -LMP,K0 WC@p `V jVV 0K$03/d `jV0@   @0 ,K 000S00 0@K`Dc 80080@0<@0 H \ 0@0/ 800C80@01K0h101 0-@LK0h  P-L2:@̀P`apVʀ 0! `! 0  , !|0 ,06d0 0!!`a0    ! b$cDcHccXd 0-LMPQ@K0h00S:\0<141@0)  <3P 00PH 0UDPD0<0RH0Xd bc -RpLP 0(0hs00S `V<08 SD @R 0C BS0Q `0@P PPP 0L00H@40B300\00T0X000 &8V`0ST0S@L@T@P``4B -PRLp/ 0` Z@P1  7P( V` ( @XPUPT0SPLPT@0SP@@@@@T@`V74B -`RL@ 0 0S 0 S<8p\D@PPL0@\ 0RP0XP0SQT0S`L`T`PP4B -`@PpLTXU] 00 0RX 0SUJ 01QT0S0T0@U; 0#! RQ&  3SHL0SP0\00<0CR1Q 057 00080 080@P@0P000p@L@$Kks~4B 0-@LP L0T00 0-@QLP0T0S@0L@T@0Q 000000 K0hhQ/T RT 0 0SX -@QLPL`L0S  Q Q`0 R000S0T@@0Q 000000 Kh( -L@PTp``LWT V80 ~0@`0S0C00008 pB8pT 0S L@`L0SP0  RT0pGH70`@/@L`4B 0-@L@0S08 0-LM@P1 < < 10D0K0 -0\`LP@ U[<S!p P  P 1S010SP0 R07c -4$LP 4`0?RH1S,@P (!<0R 0(1,11:11 011 `@P 1110111101 0 044T0T001014141<1<1D1D1800 P 001111001.1010.000 0003/P V 101I⩅ 0-LPL@U 0L0m\PPL0SP0T00 -L Mp0pP UY`0   |@(K40 @P U U40 3PP 0L00H@40B30\PTX0000  000P000 4 G4@4B p-PLM K`@P   35Kp 0-P@L0S0@ 0-X(PL X @@,\  \0`S 衄 -L -0LP 0-0LS00@@BK0hcPd -`LX0@0X0X(p@P @0S T ꪄ@#@X0( 0X0ⵄ -P@QL H0`S x 00S/_ld^ 0-@PL0S0K0h] -LM@0p0P 0 (K`P ( 1:1`P ( K$. ᫐=DC 0D@@ @ 0( 0 0(  h@ 0BS-@LP`|`P  $0S0$S0ĕP4B p-L,M 0@S`  <K_PP Kp<0 <0 SP@ KDK富PP<04KV@ D 1;;14KPP< R (0 $R !8 LPP  8KFP< R $ %PP 4K -LM0K0@ P00K -PLMp K`x@P  >@K 0-LMP@EKePE/KK0 p-L M@` KRPP  4PӋKp -LM`P8 pP (0S ᾋ&@(K0K4KǍ@P ᳋000 W ု 00 ~ 1} !* 4Sy DT 0S (4 P!a{1 504,c @P!4DST 04 qT10 414^3 40 ( C-     !8 **!@L*L xT 4Ⓘ40000ξ4墊10 4+6Wv ;s00#. <10 44v-@@#@@ @]OB bh@ -PLMp K`ᄋ@P$ : 1%@ @P% 0!00$@  0@1P pPt@ K 1$ R 0@4 101 @ 0-LMP@EKAPE/KK0 -L4M`1P1R4a0pH0 0 0H0P08 K0@KL P2@08 K<K@80 @40 H0PL00P+<08000 !PUY 4KP 0 <Nj4 @Ë (K0 <_4 @Y{ b -`PpLXXPU 0 R  R@ @D@ @Y@dP Չ -L M0 pRXP``(K@0T     R R @ 40 ,`40l 4VPU@@HXU 00I` P5B -L|M   0X  a` RM R(PX?ap REp  K4 x D | t \I!P GV@@T a @|1|0 0 0$ 00 K4Q05/ |0P0BPS 0+ pP  #P R7T9$lpK PP l0KW `(K lpK || ^P TU @0Y0X@ @PTP P0 R P `5Bld -@LM`(KpᮉPP 0( 00009P) K 0-LM@K唉PP J}PBK0 p-L$MP@U  U00R0S`"8 K<KY`P04KrU 4K<<0`18  } $ `P 4KnۈKp Peb -50L MSP`@K\!0K!4q 0@P@ 00,K00@P@, (K8K1:10 1:1ᲊ@P1(0 ̀080(K4K 0 (  墊@P40, ` `( (000,'@,T 4ʉ 8Ɖ$Ke 8a,0 bh@ p-L M` KPՈ@P  19@ 00003/@ |LKp p-L M` KP᷈@P  m  00403/@ b2Kp -LM`PpP C0 0   KP KU P  0 S 0 5 @7 %PT 00   K4B 0-LM@K1d0000P0p `P 0#`P @P wK -LIM @Pp  MK`PMK0$PK1e000 0`P 0#`P @؇P I K -LMpP`P C0 0   KP K RU P  0LR 0  PT 00   K4B 0-L@0M8K( 0$ 00 0 8  04 <0K0 K PP <0#P<P K0 -L0MP`p8K G@P&08 K43 0 (0S<0K@0K@P(0S@0 4K8@@P T 8K<J 8K8@K< 8K@P5B -LlM PPp  lKP\\K&KK 0&Kd T00X"d0 SH"K d `xK_P@x0徤Z90 @ S;# 0 t 0St 2 LKPt:40 P St <0x Sp0Kt0K0L0KP #0@?oT20StP :ZTx0@徤ᦆ (K<0St0 HKLP LK0 LK00 P40@0S   p LKCP \K&KKP 0%KT0d 0CST0 P5k9K H & HXp     I A 0Q9 0Q  4Q 8Q (QpW 1P Q @00   P S! ẳY000 000 ,X 4䐟X  4<  .<0S00  0@000000гγMGၳpW000 65B@Kc`d|btdKcLcY9 -0LPS` @T 5@1 0 W$0S  即 0-@LP30S 41x0D0>qHAq@0L0@000 -LLM`@@0pP%P&0@0` p 'p 0PP P T0DP @0 lP h "r< lKg"PP pe@00@0(KXpt0S&P"[PPp0S'=P!Q )PLt0  t0 : !t0 P t0P R $$ 5'$ $ @ @ 4!x D pHp@ L @ @0 DD'@00@0PP U1S S `@0@ 0 $0S/ 0-LM4L@LPv $@P@ $0㸟P nK0`d5B[95B -LM0 0 0pS`@UP/ P PK0S S SF10SB KtPP0S S S @0R00 @0R 0 0@0 @0R000S S Sl00S @ @0P DTP@  b*P*Pc -L$Mp4 < 0H 0C# Pz 04a@0 U0 8 B0@A80 0Sr 8 Q X00  D0 ~PPD0% 00XU^F(PUt0S< gP @D@P T04 00. 8? Z0 @D䐟 D H " 8  @H0 8  <F 80y4  B4 嶱}D H0R8 0@0U44 0  B%(KP(PldP/ XY9 -L4M@S`0 @ P p0S 5R0ZZX5J1 2H0 *140 80 0<0 |5x5d-0L D0 40S^P % 2%40 04 RN D0D0 L0S4*#) 8 80p<0SRZ   @ L  H@P$   H  \ TX Z; w0u (K }P (0S r}  8 P0 H0 1 L ! D 嬰*0D 044P0L0<0<0 M}Z 8 1SY S S0S @ p  @ @ @0 0@0p뼂 Y kU pY x"$03/x"@_UT  0P@0 ,00!0C00!, 0 (00  C< 0 ( T j@ 1R0K S8K @PE0S=8 pl!@0X  <1q@0@0 ip(a Y  U |pY $03/ @T00 P70 10 1@0S  S9c1S S0Ey0_v(Xl9 bcdbld5B>c$@5B 0-LLM@`Pp'40 0! 0 8p0`,`($@@ @P0 0400 0 0!0 8p0`,`($@@ @P00400 0 0\!0 8p0P,`($@@ @P00 400  ! 0 8p0P,`($@@ @P0000 0 00!0 004p,`($@@ @P00 000!X0 4p0,`($@ @ @P0 0(KcAA`d5B5B @-LPQk5B 0( d(00d`0P t Rsw`// -QLM0 | 0(KQe00 Y0` hV01h0#0 0 pSV@OTRLŮ뜐 @ @T1PS0d V00W0S@S 114h K"  0 S  K  $ ( K 0 l  h SKKK 0 P0 T H H0 @0 L D L 80 < )#KṮ K@ p0S0T 00S0  妮0J00 0@00 0Gsp#0<0 售Y  ,0 c0addd b 0P-L 5P \ `P/0 !`8 00 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc/P 0%P%#3/d @-R0H"   , A`T aR  d 0-@LPPQ|i00_Qdi_000SP L@< Sd  @Z P0SS10cd5B5Bb -LP'30T%T 5T !X d -4D$LLM  ㉭ \Ⅽ`(qP0PS00   4 4K0 KPi@l@x3 0 S0#0380 00T3@@0 @0@`c0p0(3@@0 @@0 Rc `tp26#p0eQ X(5"0"i8 弒@ X  R2 0 00 @5[``aVXbTH0$000<0!>@ ` @8@0 FL0,00p(00Y @0lT0@D@Tl@%@l XR:T0R0B0@@\0AJB!2S8# &S0!S01S 40 th˧PTP 8@00  4/6Bd b(=dd|bd;d 0-PLt姧 @P 0:0L0 ( HD0Rt Ct @xx0ԧ0 0@0ddd -`0L@P0p0(   Q P! 50l0V0l0 ᭧W` h ~kl0P CSl ]@0 p^V TUPk b(=ddd -LP`pA) 0@P' 0 P p 8q@5Pi0 ? P9 t0Sx x x0t )  Y@P  0P |0E' t\txA'8dicx#!(P00dd -pMLpp`P@P 0  0&U00000Qx0!t20t2t0S`,oP U (`phKU h)`pi b -LM pPP @ @@P0 <`P D0@0K` -`L M`p 0P@ P iP帀PE0V壦 PP"0 ;pP 0P 0(K P ᆦ10 ^<`pd0/dD0S @ R D00D0@ 0D0 R 0S  0 0 0T R P0ST T0P 0T0L R/H0SL L0H 0L0/gcX X- L0@-H1H!1,, N @0PD N @PD40 N @PE84 N @PE<8 N @PF@< N @PF@DD N @PG HH N @PG$LL N @PH(PP N @PH0 bgc -0L@S04`00P $@0 `@ @00K4 K(KHd7B7B4c7B7B7B -@PL0SPp`0S  ! EQQPW\PQ 0L 0000 0C00S  ! 'Q@d4c -@LPTL`zӟ 04R00 0  Q00Hd0dPd -@L`T ;O@0 SxPz⬟0S0  Q    8   Q 0 @՟@PdHd0d 0-P$@Lᆟ00C0K0h0d -L Mp0@S`0L 000 QDQ SREP00!4 P,1 P R!z4 L4     PR+傟N`       0 0S0    00PA@(K0 S SR   Q 4 4 @d4cHd0d -@`pPLUddN0`PP000S0  000$ 000 00P@d4c -@L p`A00P1SW[ R؀YXQ   000@ 0C0 00C 00 0C0 0P$Kk07B4c -@0`SLP00Q0S0S0SP/0S5:/ P/ -LGM 0p41`QP8 0241 01 1 `V\4`77H<X01 V0$1 AT 0D1 /00D@W 10P z7U v7f7(K0 4!$`F@P0$1 吓L 0E/KFK@P t W7 V `0 @O7T b7 Y<P@P 57PAHL<+71S C! /  C0Q1 00CUS0@@ӶW@ 0X K)F@P 7 T <1 D20 0A/KFK0 1  E@7 T 1!0! <@PX *KPOK  U0< 1 A 0KK 1K 1 C?K0 00 K?K .K 1 ,! 0 k&,!,0KK #0 GTP0  0KK @1S 0(P&K K/K   AR@ڸ^^Q Q OOK@UT A@DX"0#* ,1 ,1A  ,1 yA,1@v B0P@t0S^ @|d@ -LM0 ,0  o K80 41P80o/Q / -L,M@ T8 < T"p,J3ApP, KE"pE4`8 @ D o00T300@ p W0<0 E 80強p A(K -LMP40E40 0`p0E!;@P 04 K0K<@GT t@(K40 C4 /  C07s4 K00p0A05 $1$!S pW   4P44 4PE 00 卜8d 0-@L0厜,0$ R @@0Ɯ08d<c 0-L@TzP00S@ S @R 00嫜008d<c 0-LP<]80@T$K0h藜0S 3/@8d<c -PL`TpCH0@T4 0S  3/PP@8d<c Q- L S &S NDP-/ -@@PL0S0 0S!0S00Q!@` 00`00Q \R HH W@lX C0\S객@%8B7B7B 8B 0-PL@@0S00?00P 0S(! // -x1 004,@($@@ @`|0 0@0@ @@@ bQGDB 44[(Ko螘 BPPp UaL0 `0(  P}0d0(r580@P4 0S #P P0 i000< 0(KS& A PO5Ux`U낯0 t+T/0 0 C00A0@085008 0< 0L0 0 `0 P.00#580@Pu0 7SP PU<0PP R 000C00  C 00 0P 00S09000S<00t RppW   P 0/ P0  jA040p  4W 0/PqT VA0/ wZ T \4T 0t0S/80 @9A404 b|d8B 0-0L@00 P {/0P0K0ht/ X0-PL  P  P 0P $R@P@8B H0R  R/R20R/20 0-@$0L M K0h+:@d 0-@L !: @  0 0-LP@P 0+P 0#0 -LP`w@P P 0+PP@  Q0-L@K0hP 00 0- L@R(0 M 0000@d 0-@LP@DT@00 %M@0@d -LM0 0P0 0 0 00 0 0000p0 0x0 p0p0p 0P0 $0 R p/ R  00.0 .0000@T t0S .0p 00>a0 P u.0P p.000418 p`V 0 x>`0F0 /RL @ T0@ 0 T ` 0 m.0 P h.0P c.0000S 0-`t0 刡CP  pR# t0041 `$1`EY 0 +0 DP 0  !"@@Ys o3x0h@ 00 00x00S00x0x 0< 0p00 0x0 0 /R) Rd@ h k h`@T*-p0@@00S 0 0 00000000000 2x 0 0p0p 00C00 ` @A /TT@@TpH^G @/P@ /P B @ R R )  Q .P.Q* * hd0Kh KP hP j-0p 00000_-p0?@@000td0S0  t0SJ0 *0 p0 00p 0 0 0Cp  0h00 0S0S 00 00 9a0$0 S$ 0`0(05lI =K` ` Kp;L  KLK\0 8 <0 H 0LK ,>P' RKSx00 p0x h 0 00S,d0h0 0d0 0 ;P hP ,d,O< ;rt0  &K0S,80S 41 0 J0/`| 0  @@R0 {R@}` /Vt  0R t  0R0S P0 Si*0 |0/V h @ @0/`0 0E00/V0  t0S P0 SG*0 |0/V   @0/`0 0"S00S /Vt0Y dP| 0 S!*/V  @|0\00 /` t R R  |t0 5 |J0 t00 Sj:5 J?Kt0Y* 0S /Vt0 S $P0$1 80 S */V0 t0 S 0S /V t0 S P 5 0 S*|0/V @4 @00t0Z* 0S /Vt0Z PQP0$ XK4O0 S 0 */V XKet0Rt 00Ǘ0 0 t0 0 3 J0 0 0L=000/S +00S0 00 .R  .R0/S0 0 00 + 00 0 /RL 0dh0 {+0d0 x0 00Sh h0 d x0x 090d0S p  ShP SS^+0h0 dh+p0 d {+\dr0x0 d0RC hP ``\< T+dR+0p d0 00000x00Sn :S_N 0 00 00C0>KIGx00) hP )+d'+0p 00000;P& +$+ Q  BRhP P +0h0 d+0p 00000*x  <x00hP d0P*0h0 h0p 0d000S 0 (K*f^$: (|d bld8B@@dTcA9BA9BAmdmdAAldld9B$9BAg@ 9Bb@Ak@9B/A 9B9Bt0 S v 0S? /V pt0Y lPmx0 S Z*/V 0 |0 @Z:^ t0 S n 0SW /V ht0 S vPe0 S 2*(/V 0 |0 @R V t0 Sh 0SO /Vbt0Z NP_e0 S 0 *0/V|0 @K:O* 0SN /Vt0 S, ,P PN04" XK~M0 S */V0 XKt0 St0 S 0S /Vt0 S  PON$ 0S /Vt0 S P ONt0Z:t0Y* 0S @ |}V0 {  0@ 0| -LM(0(0 0 [, $0   K 0 0   ,K@,K*K -(0LM(0 0$0 0 0 0[, 00K00 00,K @,K K p-L$M0@PP?P^/PPPX`(000 0[P0 0K04P,P (P 4@ $P ,0 ,0 ( < 4 PX0L `d0$0d0-`P P`d@c0NOPd 0 pOPd0 OPd 0-LMt0@S@9UPP@p0K!tT@P@+UP@%K0 0-LM@P 0 OTP $t0S# Sp0a@P 0 QP 0K P ,`%V UPKp0P ` @  @0S/# -L`0000@

T C AQP*WV$@WV -LMCpPt 'P P6 P-T3 0QP</H(3 SR$ " "HB P 3@P ^G$KVG@@2P^P tPP[ D0SO@ 3/@d00Cd0Tq P(R q3$ b SPU D0S< d0 0d0剋D03/@ Bd0T0Cd0-`JzU40S#qX Gt(|Q@T\dhFXFP0@ F,FO@hPh0Fh@,`Q$,5@`, 080 080E$080@ml(K(@((0 P9(0d00d0,@P dcG C#K N P 0N.0 0 lF`8 U8 p @DpU ,D D(KPdoA;B;B;B;B 0-L@rD K0h,0 0 0!04K 000K,p(`$@@ @+ 0!0P4 K000K,p(`$@ P@ @*0 T @哆(K0@0dAhcAy=B=B=Bd -LMphaP`@|` 032`P&W  pl@Th@T#婆 /P `0 |0P s 00 呆00`(K^ @0 |0P03 0<300v-/B @ d  -LM#K`0`000p C4 c00(!@P0! 0 00  01PP܀l@Th@T7)KR0|0 aP z t% P(K @)KR0| 0 GP @d  0-P@LPt00CS 0p0!Ñ"h0|0Sh0|  0h@0000 -LM 0 0Mo K -@4 <P$p?L`McKv$zfT(Kp0 ß#K 000K0 0 sMP j@p0.0 -P`$@L[Kh薅d 0-@XPLLH0  9H00 S0 1 0 K0hzdd 0-0| L@RP R| |00S H0  l R;H00000K0hn!Ced -1| LPR@ R| |000h`S H0  l R;H00|0S0|  P`H0l` t0TpS S JMP  `0S (0@g!Ce`c 0-0@ L R  R / R     , +, )R Q0d`c,0;,0/ -L,M0@Sp`0Q`-` 僄1PU W@@hP 0 LKP0 P0VL0K LK KK0LK-0K`V`p垄@(KdP d哄 LK` Jd V Bd P0p@H`d@c -QLMp`-P 0SP R  P010W>00$K@KPP@D@K P ꌐY .@D Px@ Kx KPP K⺞PP `  @@hc 0-@L0 0 0000p0`0P0@0x0|00 -LM`Kp@0$@0 K0cKKШd -LM`Kp@0$@0 K0cKKШdP 0/ @H%[?KU 8%(K1%`-%P -L MP0`0 00 0@(0 `& 0 p0p KK"K2K+p<0K N,pP  ! 4O$K8 u  Qp@ p-P@`LM$K"K@` )Kp p-@P`LM<K"! K(@p+Kp -`PLM"K(pP)0@S*   0 00BPK0  0 00 BP K0S@K"KḐ 崀 @ (p0+$Ky Kxx p-dpL M@` K@MPP  000dtP LKp -LMp4aK@CPP 00 00 1P 0 =?K PP 0S K*0P<:PKAK&00 80K!:#:00 K0K'PP+ -LtMpPK`@P080 0<@ d@ `0 >dK4 @P  KPPt0S@`0(00K0 0 0 0'K0p0 41"KD0ጀ ` l0 t` *@P "'@P t0`F0` -dpL M@`p (KLPP(0  K0 dtP 9L -LHMP`` K@P`pP`Z @K040 000 `0\@ X0 >\K, @PHPL0!t0Sp RDU# S+R@ 4 KW)@D``*R@4 K(@4KD)DU]@f -LM`P KpJ@P KD@P00 00 0@ 0 )>K| @P嘀`pAY )t0Sx00 Sx0 .R0.S 0D0 t0S\280@0 0l0 0h0 >lK< @PvTPX`U )40DKS800.S @]S80 .R0.Sg `0Wf0T03/@PK0 XK@P;V X`VS t t0R(S@(XB X 0S!Yt 40R8xi@P 0@ K d(0@X03/nl(KS@VU L)J)0X03/ (V K ( @@@@X@8  -LM@!p!4a,KqPP 00 0P 0 10 V=K PP PU K(U US PKZK?00 80+K1+ 0K K(PP8D b -LM1a@1 4qM5ZP:E?K+@P,K @P'T10S ! B< 00 00 0 1 11 PL0`  aPPn`6}(0 M85 (00(0M8(0i}lY  0S 0 Y PW0 LKP TPpPP -0S !(Kl3Q LKTLKPf0LKL0K0PX0 LKzLK0PX0 0\0 d P0L  `@(0`0 2 `0,0   0S @0 =PPgP |( M8M( 0&(  ,000,0(2 0 " 0, (00(0 0PX0 d  >pd0Y 0SV, (  ( ( M8(0,0A ,;*S |YT`0d:V 0 P 48(04(00S T\0SF XCS 00@ 0X PK PP3\ PpP-PP` V 0 P ,7(00@P@4A}m?Bb?B -LM 0 0 0000 s K -LTMphK @P 080 h0<@ d@ `0 ;4 dKL@P h KP`h`P&@@0 <@P (0 L0@ E@T0S Sb -LMp K; r@P SK^P{(` @0(0"@(0@0(0{ -L -L\M3Pt K@P t0``0 S?:@:\@:@:@:$A:LA:|A:A:A:B:TB:B:B:, dKPdK@P,  t K 0dKud K@P dK@$ 0dKdd K@P$ ( 0dKW pK@Pd KpK@P(  pKp֔@P( dKД@Pd KpK dKŔ@PdK@ dKP(dK@P@ @ dK寔@PdKp@ dKP壔@P dK@P@ 0000rp@ dKP劔@Pvp KdK@Pp pK◕P@ dKx@PddKxp @ 2+Pf@P 12M @W@A@@d -LM@ ,KHP,KK -L$MP4!Sp88! w@P00Sp!8@TQ \ 1?,@K00$0 3`8 <0 ũ<00<0 0@8T  1(K0080 P 80崐 nP00/S S 0S@ +T + @ 1(0o80 @d|d8B -LMPT0`p K@P 0 0 0`m@ #K@ -`PLH  0@`P ᭔` -PLM Kp`F@P  04 00!0`5@sFK b -`PLH 0@`P u` -LM41Pl@80 `@p0K0TPY8080P 00 0`0P0U'@T00U0S 0 p@0!UT*0 0 0P0 3/0P0`P<P@0 3/0P 080 a80(K8B -LM0 000 K -L M40K FPP.00@kbt0Sp"?!pPp`V#8P n0S$  P$p Ứ,P E(KP!U4KP'U4@@ -@LP4q 9 `4P P {P P}T0&98q9 0$Kke -LM0 4p00`r9PP(KEPP(0h@t0SP" PX#U 8/E K p-LLMP` K`@P T000 `04@ \@ X0 7, \K@P `GKpH0`0@t0S@" @P# p-L M0 K4A`P 8@ Pᡧ` 00Kp -LM04a00@p 8PP 0 KPP 8;K -5PLTM`@2 4qpKtK8F@P+ 1l@  P0D@ @0 h 7p0Y< 0 02lKl  @P p tF0S 0P 0 pKH@Pp0 0 t@(KX0BPp0 t@P "p 0t E -p0LMR`P40 08A Y  8Y $00K3/ @NT T+0du00 0000w40@S 5D껸@0K@P0/S 4KkD@P40 00Q(K?c -p0LM@`@ \PP @ (0 ?@4K b -LM0K00@0 cP00K -LM0K0 0@0rP00K p-L M@ 0R0P 0 BS``   6   K 00S03P R30Kp -L M,`K& `rPp0@@T@30P00 0_pPP (Ke 00-0LP@0P 000S  K0h?F0-0 0AS-Lp@` P``P00S!3 TP TS @`! p-0\ML00P Z7@PhK@P T000 h04@ \@ X0 5, \K@P hWKpH`hQlKh@T `K@Pl0K 00S03H0 @Pd `0S@3:l@l -LM@0!R !4q00 0 7PFE@^  \KKDP; K `_PGKCY?t0S-:  P5 # P- 0u0X  X 9v@0 P   C (K `)K 0K*K 3P  vDP  b -LM { K -LMP000`p 6@P$ K@P  K$@$2T @ K -LM@0KP KVK -LM`000Pp M6@P, K@P(K,@,T 0(0 0`@( K p-@ ML`Pp 0P00`P$ ` aKp -LMP0400`p 6@P B/K P@P`pP @$K00 1A ܀ 1 +4AK @PZ`V0@K'80!:#:00 $K: S)  S00   S0 0@TS"$KSR;@KTP> V* ' S)0  S00 00 Ā $K0TS )S S0K KK K= @P K$ 0K KK@P -LM@# KhY@SK -LM c K -LM!  K0 c8 c86 p-LLM`0  1 1 d0K@P+`Kq@P$0P00 `0\@ 4P X0 k3\K, @PH0DS@dt0S ` `0R@4 K@D Dc `d_ Kp@4KDH0PT HP] @@ -;ML 000c0  K -LM 0;0 00 K0 c 0c0 0-LHM0XK@P$P0T@ ,P (0 X0P0 2$ TKB@P X@0<S(0,KD<@0P  @P X@K0  ,KD@P ,K<+< 0 c,0)0 c$ -LMP w@pP 7 (0S>`t0S: 0S S S, @P @@PR 0  P0  0 KP 9@ (K@*K/ -LM`p&@PP 0? @(0St0S !"K  @P ,0K0 L@ K@? 0-LM0KA@c 1MK0 -LM`p?PP 0? @(0St0S !"K  @P ,0K0 M@ K@? 0-LM0KA@c NK0 -pLHM0P@' hKT``@Ph08` <@ `0 d@ 14 N3 ` 0000dK 4` Z@P h3$KhPW@ PPP @P @ -0ML0 c K -LM 00 K p-LLM``KP@P`0P4@ \@ X0 0P {1\K,  @P `BKpH?@H -LM0 c K 0-LM@K@ P@0cP K0 0-LM@K@ P0cP K0 0-LM 0PKP @00@P ٌK0 p-LLMP`K`@P T000 `04@ \@ X0 1, \KU@P `Kp H=@H -LM 00 c K -LM 00 K p-L MP@0` KH@P  @  Kp@ -LM@p K>PP  0 `PuT>K p-L MP@0` K@P  @  Kp@ p-L MP0` D0D0 0K@P  @  Kp@@ -0ML0 c K p-L M@` KM>PP 0 P=Kp -LM 00 K p-L MP@0` K@P  y@ U Kp@ p-LMP0` L0L0 0Ks@P@0  t@ 7 Kp@@ -0ML000 c K p-LM@H0` KsPP0 00LP  Kp@ p-LM@` K=PP P04P=Kp -LM00 00 K p-LM@` K=PP 0 00P[=Kp p-LMPD0` K@P@0 @  Kp@ p-LM@H0` KPP0 00P  Kp@ -LM@S11\Pp `@KK0s(0sK0Sp"0K Pp (K 0S  PK0sKq"KiP`  K&KQP%`\0V``K50 sK0 s KVKdKY40"K040 ZW ! P0``@@ p-LMP` K<@P 0 @0@0 ce@<Kp -LM 0  0@0 Q K -LM0 cC K -LHM@PP`p 0S <KWP<K 1ST %K? T  1SD !$K? D \K0 0K - ML00 @0 K p-LMP` Ke<@P 0 @0 0@<Kp -0ML0  K p-LM R0`P@"0 K@Px t0S@ @P"]@PKK K)K"@ZKp@ p-LM R0`@#K<@P0 @ PhN t0S@ z @P K )K0K P@;Kp p-LM` K;PP 0L@% 0 0 ?P;Kp -L$MP(K;@P0( 0 @) 00  0 a@@@L0 0R`p@ 0H#K #K` (0 @bA; K p-LMP Kz;@P 0 -; @Kp`@ 0 0 @8; -0MLc 000) K -0ML00 K -0MLc 0 K -LM c 0 K0c00 c0+c -LMPp$K` ;@P$ 0 @ 0K @@0 0p)@0@0S 0 9 00:Kld -p`41L8@ PP100:#:1ᣝ p-P`LMp  K@T+0 S0X/@PKp 0-LM0<P K0@P@K0@ -LM`Ё 0PJ 1 R0R 000(K0K :P00  ` @D t0S`  0`A :` -LM`Ё 0&J@Q T0R 00K O:@P00  @ PP t0S@  0@ 9(K@0S , !P CoQ// b -PXaL1BTJDqm@T (0SE101201BMmT,%@m, !100@S$ $0( (@5m1201Bl0P0   PU 0ST mU  000 @0S @$@ bddd@012SQ  R R0/0 b -LPxlp@ 0S0\@ 0,`0S Q R$070 30ddd 0-P`@Ll00CS0 K0hl(00C(0lK0hd -LP0@S00 `,p$P 0 P0,,X HNl@pP 0 P0l/dd 00-$@L0:, 0K0hnld 0-\@L ,l l l( / /+000d?B?B -`PBLTB0S opPP PP P@ -Lp P0@4`0PP P PpPk@ ld -H@LP`pk0000(00(0 lKh6d00S/ Ld00S D/d00S/ :d -81L0S0PS0C01p(0S+0S4 ,k00:/$Kkk`1?@T  R   R  R R R  0S  B  s1?00$Kk+ddd b -L001@o b -L Mpv@XP5 `ܐ6kp;+ P!UX10WPP0T 0S 0S 0 0P0  $PD00 x/PP00 X0 00/ Fk(Kd bd -L00 0-h0LP0S-@ "U@@ wkP#@jk@P k0dd -L[ Kh kd -@Lp`pj@\000jPp ` 0 0S 0P0 P0nd -PL`p @T ^T0S0 R @S     -0L` P;0@t0S`2P (10S00PS00* 0S( *Tj@ 0S00j pW@0;00S0C0ʖ* 0S *p9j0h0-XujP-00*0  3/@Pp0*dddd -@`LPj0S@00@0  Q  ) U0P00@0` 000C@0@0@@@08PE_oRSPU @f.Kh'jhchbhc 0-@L,P0SS0w- --L M % 0-P@LT  DT0@00P t R'2`// 0-@Lidt00CS92,7-  0K0h!d 0-0L  @ 0 L,D-000 t00$#00Q0d@;Bic 0-P`0L0T0@1AT0 0R 0RP @dhc P0-L@ P gT BpP P @0 <0Q4 R/000 -LTM2@a00H0`p Ā atqH0@<꼥:l:t:|::::90000000 0#K")K'0K@t0KPd0K`T0K00 0@0000404;$x0| Kp9:: :9: P 0-L@Pd 0@?o280K0hZ -LM@ptPL\UPP0 \-K R00(K-K 0 KR0T0p0\2 QP 0 P0000P\PPPP\ 0` 0`  1ሡ"K  0S!P0` 0 `0(0t0S2 011" 0PyZp H;(#L0妀10#00 _L0X0L0 aH0;H0Ka 0p0`0Pp0Y K!-K K  JZ00P0SpP[  0 @ b& 0-P@L$#P 0 -LMPpt R`d02@@^ 1Q|K @ T 00C#  K410S@$1Q  R>@ @0Q  R20K@0@?u @0000S@ @0 L 0@PVp`n``014120 @ P`T @@f@zfzfat @Mc b -Ppt,0`0QL@ 0@L`0S% (0" MKJ{   }P 0 0  Z   L0J  -Pp ,@0@L`0 MKJL`?   0 a0@ 0H   -T2LM0@P 6 42|1b,048<0,0.  ( 0L0,0P  PW( Y({@K00 0W 0 40040 0KsP  (K (p0D08[ t0S@ 0t0S>  #  *  ~pP! w_X00X0_ 0P0W0\  pP Ku 0K*K  pPp-pOp b -PLP@` 5_X00CX0r_ DPb  -L,M`pP@P[T0KL0 0H0 $K 0T P@ S<@ 8 LK LKQ@PX0 LKi<0Y@000P0S@W (K041D040 i -LK0 0G/Kp0$0@$000c-TV0K0@ -LFMPp`0 GKoy@P 0I/K@PGK0 0>K0 0G/Kp0$0@$}000c-TV0K0@ -LFM@p`0 GK=yPP IK-'PP$1GKPq0 0>K0 0G/K0p0hP&000c-UV0K0 -LFMP`p0 GK y@P\0.K@PGK@ 00G/K0 @ -TV@K@ -LFMP`p0 GKx@P\0.K^@PGK 00G/K0 e@ -TV@K@ -LFMP`p0 GKx@PK&@P 1GK@ 00G/K0=@V&-TV@K -L$M`0p0 K@P(`,0K00 0@PU,0PV,0 `F(0K000zP P@( ,0( 000-TV@ K@ -L$M`0p0 K@P(`,0K00 0Q@PU,0PV,0 `F(0K000?P P@( ,0( 000Y-TV@ K@ -L$Mp8K&@P*`80 40K00 @PU40PV40 `F00K0 0P P@0 400 00%-TV@(K p-LCMP`0 GKw@PP0.K`@P GK0G/K @ -TV@Kp@ p-LCMP`0 GKw@PP0.K<@P GK0G/K @ -TV@Kp@ p-LCMP`0 GKw@PK%@P  1GK@0G/Ki@;%-TV@Kp -`L0L@#2000FSP`VP`0P V`00 0-T0LM% K 0  0$KP @Pd0 K03/@$K0@ -H0LM$0   0) K(K@ Pd0$K03/K@ -LH$M   0 - K0,K@( $ Pd0(K 03/K @ -LH$M   0 - K0,K@( $ Pd0(K03/K<@ -H0LM$0   0) K(K@ lPd0$K03/KX@ -H0LM$0   0) K(K@ UPd0$K03/Kt@ -H0LM$0   0) K(K@ >Pd0$K03/K萖@ -H0LM$0   0) K(K@ 'Pd0$K 03/K謖@ -H0LM$0   0) K(K@ Pd0$K$03/KȖ@ -LH$M   0 - K0,K@( $ Pd0(K(03/K@ -LH$M   0 - K0,K@( $ Pd0(K,03/K@ -LL$M, "K 0K!K01 K@( Pd0,K003/K@ -LL$M, "K 0K!K01 K@( Pd0,K403/K8@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K803/KT@ -L$M0 0D$ 0 1 K00K@, ( |Pd0,K<03/Kp@ 0-T0LM% K 0  0$KP f@Pd0 K@03/@$6K0茗@ 0-T0LM% K 0  0$KP L@Pd0 KD03/@$K0託@ -D0LM% K 0  0$K@ 2Pd0 KH03/Kė@ 0-X0LM$0   0) K(KP @Pd0$KL03/@(K0@ -X0L,M40 , ( 8K "K !K09 K@0 Pd04KP03/K@ 0-L(M\"K "K 04 9 K0 8K0P0 @Pd04KT03/@8K0@ -H0LM$0   0) K(K@ Pd0$KX03/K4@ -H0LM$0   0) K(K@ Pd0$K\03/KP@ 0-L(M 0 0\( 0 0$ 4K0 5 K0P0 , @Pd00K`03/@4dK0l@ -LH$M   0 - K0,K@( $ xPd0(Kd03/K舘@ -H0LM$0   0) K(K@ aPd0$Kh03/K褘@ -L$M0 0D$ 0 1 K00K@, ( GPd0,Kl03/K@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , +Pd00Kp03/Kܘ@ -H0LM$0   0) K(K@ Pd0$Kt03/K@ 0-T0LM% K 0  0$KP @Pd0 Kx03/@$K0@ -D0LM% K 0  0$K@ Pd0 K|03/K0@ -@0LM! K0 K0@ Pd0K03/KL@ 0-`0LM% K 0  00$KP @Pd0 K03/@P $K0h@ 0-P0LM! K0 K0P @Pd0K03/@ mK0脙@ 0-L(M"K0\9 K$0 04 8K 0 0P0 00 }@Pd04K03/@8MK0蠙@ 0-T0LM% K 0  0$KP c@Pd0 K03/@$3K0輙@ 0-P0LM! K0 K0P J@Pd0K03/@ K0ؙ@ -@0LM! K0 K0@ 1Pd0K03/K@ -H0LM$0   0) K(K@ Pd0$K03/K@ -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K,@ -H0LM$0   0) K(K@ Pd0$K03/KH@ -L4M#K0dA K,0 0< @K(0 0@$0 08 0 00 00 0Pd0<K03/Kd@ -L,ML"K "K 04 9 K0 8K0@0 Pd04K03/K耚@ -H0LM$0   0) K(K@ Pd0$K03/K蜚@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , zPd00K03/K踚@ -L,M 0 0L( 0 0$ 4K0 5 K0@0 , ^Pd00K03/KԚ@ -D0LM% K 0  0$K@ HPd0 K03/K@ -LH$M   0 - K0,K@( $ 0Pd0(K03/K @ -L$M0 0D$ 0 1 K00K@, ( Pd0,K03/K(@ -LBB -P@`xP0Lt0@00d0L00L0 0(1 0P0Pd 0 //0L0// //0/ -L -L 0-@LnlP 0P qP _0 0-@0L$ @ A0 -L CB -0LZS -$0L@0OS/ // 0 //0@-0S  0S@@0S  000C S:$:$:$:$: ::$:$:: 0( / 0, 0 / 0-@PLR0S0K0hS -0L`p0@0 R R T PH 0P@0  00X00P0 w 0 00 0S 0S  1 R00S 0S00  |0  1 000? )K1/0P0 L0 R0ZL 0S 0 P L0S p ELP%61`jf3@ 1 0P0C0 o10K1 0  S:#  K0R0 l00 l*K 0` I90 0  i30 0 GK630 90 0  'K KPG?K R0`G?K ñ` 0GK 'K 0KK 'K 00 KKR00P0?'K 0GK %KSR_G?K0p#0d#0 `p'KH0 V &:1 1C|0 000 hK0a1 S$K01 00C0 G?K 'K0  P!#@Ơ'K \0G?K R0G?KñP R # # R # #  )KKSR00 R00S  |  0 B 0) I 0i"030 90 K'K R02̠ a P SQ US10 K%K 0h#!0R00 qW !3/o"## @030U0V0S 3 ႒3@ 3  P~3C030S00 PPaCBt=d b8]2 -L_MUK 0P01 l<1D1 `K0K?K *R0$  h !R $A!჻ !$10CR  Ц ,0K 1@E?KlЀ 0$  K?K  X0 R0SK L1H#*PH6 $! 00,0K LI?K0K?K *0( 1 $10$1 0L1 @1 01  `MH0?p1S \1L!` t1|!0S3Sx1\1 V5\ Q0p A $1 q l!C?K1M/KO/KЀP  R@ԀP  UKЀP  R@!I #RFl10l1 l!$1Sʄ1S 0CHM?KOKW V R0  ,0K #R0 00 K 0 .H|0$!CK0@18/ GM?KOK R0N@0hq T0 00X@w h0d S  d 0x!R 1 必1#  #XD!Rk1 d! D1X!S 101R0d1S@dAdq BT0S,@ T0S 0 GXhq !$10C6K/K0 6 b(=dbaCBCBt=d;d -0ML 000!  K 0  / -LM@0Pb ,0F00 0 0) K8]2 -LM@0Pb v,0F00 0 0 K8]2 -LTM0$@P0  @ph K` S0 0 0`0 01S@@Th00S (K0K6#P02G@@,G1 12l0 ,0K, #&KG XX0S@X FFXQ1T GTh00S u13@ K6 T T K@L  KLKH 8@ P < s l0LK@P< R T幺T 3@ 03ᦄ^p bt=d -L,MP01 r0,`(@VT0KT LKL0 @` PP H D@ 8 0Pd0PPEl000 L10|0 @1 <1!&sY3:| 1p0h0 000P0:#:00$K-῁|0 8 PlOYK00000C0 0 00C0d04 K00x 4d_>aCB cb;d: 0-@LPE0S JK0h?E SS-L`Pp@ T W Kh -LMpYPp`~40K0@ 0 4/@P 0T00S4 740Wc Sc $03/@Pp0SV00K0 0 8/PP 0U00S0@  r@4P 00V2 W6 4P 0P04  $00  (K40t Rp0S 4P KP40P x0t0Sp0S P 40P 7P0P PP@ @@ -LM `@ 0 WT  kW g0 000P0 @ Q S00R 0T0R0T0 -L MpP`@PW  O   ( K!P(0S K -L M@p`PTP@@  KUP $ K@"P(o -LPp`@P   Kh -L`P@PPDP -L`P@P P -L`P@0  P  KhEA// 0-LMP  0K KS@P 00K0P/ 0-L@M0K #0,(<@P$  A ƒK0CB/ 0-0LP@T@0@06 -L`PS@-pP000000 0 0!!!!""""####$$$$|0|0/./ -LMp@ K  P`?V 0x0t0t0 0CSd p0!p|` 0@Pp,0`K p-LM` K@$1/PP 00Kp  4PP PP p-L M`@ K'PP 00Kp s PP PP |0 -/0T0/0X0/ -LLMP@ 00 0L `pd00  \\H`LKlK 01s  V! > R dP9 01`VɐL0 0`d0lK13/L0K  r P   p0 gp0` VɐP00X0S  P 0R 0 (K!|  p ip꜠@A - L@0` `0(0 00CS P0 |00 d013/ 0pPp Z `0(0 00SPX00`W  `KPP - |q qq cP@WVDUTq `(bP@WV tQ01  `0(0 `000// 0-@LP`0003/P0`0 ?!00` tQ01& (000// -0LP| @` t00CS(0`003/`P 0 V=X00X0= -0LP` |0@C=X00CX0=`000Kh/ 0- 0L@0t00CS0`000K0h/P 000 |0000/ 0-P@L^`0003/PP| 000-0 -@LPT` ` `0R@A`0003/TP P| 000  0-P@L)`0003/PP| 0000 -P`L|0@`0003/P -@LP`0|p`0S00;`0SX0P`0 `08X50\ ST 00C 000C0t0S  b@dblg6Hj6hd -LTM@P0S^ `t0S SZp 0 P (K R0p0 !11000L0K"P[8P40cKK%K p IE$+4pPKh K 0PP h00 0ES1 Q1 P/Z0SY hd bCB -LLM@t0PS Sr&p 0 np(K0S] R0pp0t!p11000L0KPK8@40c ?K&K%Kdkt 0`p&KԬ0DZ! T0@00 0ƒP P0 `0`D V `! qpP PP0K00@0 0TpP YP }P0pW0SVpT khd bCB -LMp`9Pp0S A :0 UT t0S S ZK@P s6DB -@LP9uPp0S a90 WV t0S 40 1Kh`pKh/ b0t Rp0 -/ -0Lp0P 0-@LPt0Sp0 00S K0h0\03/-P00 -PL@E9Pp0S a|90 WV b P`pPP $0P09P p-LM@Pp0!"K9pPPJ9t0ST Sa90 SH11412` Q@8  P. \ )9C@8040C0 H t0S009X2K0t 1R 0 0/X800S88000d0 1P $KpH)t0S KL @Mc bd@d#DBADB -L M@04 4p0,0!$!60?UKYDB0 p00/D D0 4S 40 60CpS//د@ -t0LSp0  \<;fA -L `pY U38"-?  0Sa00 000a00pdY8Y  ,Ko1pAUTt@t0T 000@dd -`pLP7"-0?AT-8t0S p0!SR7P 8p0@U p000S 8p00@78P0@@dd -@L`P70?ST T|7AT0tp P@T pP @77P@@ddp00/p00/ -p@LP\`{7 R 0@0C0 00007 i7Kh7@d -@p0LP\7pbm ?`Q|Q010p`p0@L0D07T ` Kh[pQ00@ddiDB P 040////0  00-L@P d 0㻩0 .0㴩0000 -LM P0@"U`TPpZ W0040 000 U}Tk} 0 .0ㅩ$KKd 0〩#K .0z(2(吃"K0"d 0mŸ,1#<0#80# <##K 0܃K#K T 0YX#* < #K<P   ?#K 0#K < n#K<P   ?#KYX 0耟̠#K@#K ?#K#K 0YXCK 0<0C@_!5 0 @P㔌 圕) 0 .0 @PT0@P(K:m;,n -PLM0`"0"K0 ܨK#K 0ըK0 "R0e0"@P&> Ĩp\!8#@TPL"0Ḩ@ 0@!0 @TP"0᫨Ÿ@,1#Π@TPCKLX%dq 0L^.!1 ?@P#KP R0@ ,#K R0@#KP#K R0#K #KP R0 p#K R0YX#K   n#KR0K40.@ @0E. 0K@@P< 09< 03 (K:Q:,:mnP/ -($PLp@ Q#R000$00U (0P`#V0P9PQU" !$+4 P Y8

4(@{40 -0L@P`l*4U 1P00S0Ҩ0ը0Sp%$KkW40P0UPU I403/4#YP &00C00SY $0 0 b 0-L@PP0K0h 0-@PL300P 00$00݉峷K0h4 -LM`/K0P (@T>  0_07 0X00ݯ lV0(K/K,K 0E KKYȐ ` Ԁ P$1 0 1/P ?`Vp -L Mp0`Pl (K@0X"F@9@A0 0" R( 2@$ Y\0 10 `:6/P ,0 10::/P  b -L$M0P!8!S` (K1 @0 R 0l@ 00S 800 0S 0K3/0(p80 ᵯ0Q< PA&F``I`A `ᩥT800S0S P0<0"R0B0SP0 ?R0 ̟0@pV@0՞V@1@!@ 0 .^R0a  fP`DBADB!EBDB -LM@\Q"V Pl0)|`P Q00 pk0 RU0$X 00R 0$U+0 WUT0PTP  WP0PPP%0X00 $Q 0p 001/0P 00 000(K 50 000U 8Sb0S -LDMpQ@P" P@000 140 #KR0#K R0R0J4 0(KoF(K -LPP 0SUow/`t/P\P@ 0!QP@A`//@ B -L M`p|@P`A 0S`=U_K/帐`G/ /P  *P`&;;S+VĠ QP  0tt` I*"K-#K"K 0K8/``T/R/$K BcEBX@mEB -LM@P(`PpE 0SD0h0S@ p0 0p40T 7C 0C0T 1C37CT&0W h0200 Ki@O s@ J@0 s**+* s K}d(@zd@ -goLP.똁p唲@P, 0S p劲1 CS!1 01.00$00妄..0ho@.T 0]@$Kk.p\pP.w0.0000000 0H0H0$#0h0p0!"$0Tp$00p0L.T00T0.Ou;|b -LPa@P0 0S0h R00$00,KoB$ R P`0 F69 f&18p嬠P#`7pdgo .101ʾpC.,KoJI -TP`L@0S00go0-1 CS!1 01[0 $&A.Kh p-L MP K` @P  @P Kp  @P  0- 0X  X - w 00 -LMp@PP. 0SP*Uo-`-01S0d0S 0K PP0 h d00d0P W,1(100(1,1,1(!001`--K 00-@L 2P0K0h8@ -RLM@` 4K, 4pP, 4K☝0 ` 0 B ^\ 1p0% X`ß v#zf08 0 $KT## p-LM@P`4P 0S 0`0 0 .KpHn;tt; p-LM@`P 0S (0` 0600g.KpHn;tt; -@`@Lp=\P0T*0QU@CᯟP0婟P0\0US $Kk dd -QLM`plP,t@T, KW 01S@ dKdq  K^q,K 0-0Pd@LT@Dd@OoB`,U,T 0 h+ 0h 0 -L`@P 0SU_[,`X, V,1(100(1,1,1(!0S01Kh`,, -@UoLp4,0QUq,k,P`$,Kh -P@aL M~[0 4` Sp ATb Q_ pP00[WR1tHlV0 ]ǖgo>+1SD+,0  H0 0CV  0 萄l+ p00Cp00S  . l,p忯 d vl#[ 40\0!`00v[+M"(KP101A dd`@@EB 0-LlMP0P  4K3P*R0n!#K@-ᜀ堐***+0 <0 0ᛀ P0 ]o ׀ۮ ᛖg? T0 N+>X0 l080 M+Ht4 K*$K+dK&K R0`p*$K+&K R0gKdK`p 0gKdKR0dK$KR0 \gK$KV 00gKV0 \Qp0P 0p0t0  0t@0 &KfKSR<P8:+X XT*pR!(K3 0 000KZbp  RW' @bZX6 8*p080Cp00S  . +PWp<L D0 墝PD0L  p0W !D %D0W0 !/P" iY 0PZ8*p08 0Cp00S  . *XTu*pv ` BoP ĺ0 ᅞ <P `21 01@0/10p `0p%* ! 00*klP@^ @ @ `<0DYC$KdKWV' 0'Au;EB cd dEB@EB@o -LM0P1 0GK p1  1 04!CKlD 01 *t@T`p00;* K1S0S"`j Kn Kf0e0K0 dKn*%K+DK$K nE/KK=`P 00 0@ -@L-YPp倐0T:hY0aV ❜P UP (% 0 ~@d dFB -t@L`X@T:LTYQU 0qPGY@@ dd -PLX@DPD`0T:,Kh0Y0Q ?@d dQFB -LAQX XៜP CPP  X`PPpU:KhYQ  R 00 0 S \0 0P d c[FB~FB]B]BddFB 0-LM01@L0S Q nX K P8K KR P1 < P  XK0   P R   &PU  03/P    P ,P c dFBGB1GBd`GBGB -LM#Kp01`` p(d@T3 @d@P@h000 (U&0}&  0  0 $0 0P#KP#b0 2|P } (Td00Cd0 04 ((K00K P -PL M#KW`帠 X:X(K AT pʲ5P #KQP QP UP ᶲp峲 d dGB -L@HPt`<傴80$4SSAP0`@@ 0`( "4`#/ -LAM  G90@ 0CPP0 $4"4 8##<00$4"48#x#<00p48 40 80 <0 0`$ 4"40#4 0 0$4"4 0#4 0 048 4 0 8 00 $4"48#(<R=0Pą0ą#< ĕ0ĕ0P 0P48 40 8 00 $4"40#4 00$4"40#408#8 S:L3YD#W G8<  2 B1 BS B Y V 6l0P1 1S(K$0PP0 #4"4!0-* ' P$PT!TXX\\``ddhhllp pt 1tQ0 iP iPTP1 QEKP军C?K0C 4"4C/K B0C?K  4"4C/K0B?K0C 4"4B/K B0  1 Q![0RP KL0K 1 k lKk X K\ P T kK&PP 1 Kd1 p01 VP 0 04PNREGBMPHB&HB@ B0HBsHB -LwMPpP7p P0@#p? `P] PQP0S R`kZ_K8_/K&KⰖ KT 00S 4`5P0X S1  ) 4`,L oooH0/! 1 1GჃ|~@!P1 @ ` 3< u`P  (K k Pp {Kᥖ {KPp1 SwK▖{/K&sKFw/K&iKB K0 1 82 {KP1%1 , LKj lKjK" X0%K3S ?081 K1S 0S&00Xx iKKjK!P7iKK⡘PB K_Kj iKKjKP4i?K_/Ky Q#?0000. A  Q#?0000Q 00Pq s?K0i?K0 0XLg`LP K8C^@HBHBHBIB=IBqIB̢@ܢ@oAIBIB0HB X- HL@ڠPP@ `M%@T@D%3c -@PLpf/Z<(00`$ R< #03, %@ ##:!0 %,0500540%4 500, 08 g00 g0 H0<0 X`00080``00`Դ0 #(0 0<0`0,0$0@000(040,0Kh褷3cDBWEV -1(L@!60e`P 0S00$Kkz꜀$0$P0CS&P80 p4RvW00 BRP1`|0W   0  r0PCP$P3c -@L F@`PP@ 9@A0tpD$ VL0@L@  VH0@H@$0SP0 $@$@r$`؜@P$3c4d -DADp F@Q9L` (aP$ ԟ@PV $  P  Ϟޮ@Pw$ V PXU0S 0S 0tPf$ WL0`L`  WH0`H`$0P0R$P$3c4d -Lpᨮ@t`#P0SPU PP6$U `)ᓴᥴ# -LPႮ`@` P#p FGE`X  ;0S y0 E)PKhJB'A c@ -a fp0LM`@`#PP@ 0S9`aV@ #1X 1X @0 00p0 0up@ (K0@    #@TX #tp 0q` X#V @ @T 0 Hiᘀ3cr @b p-Pp0L `0M@T`ẞP 0S 40`0 0 $Kp3c$84̙; p-Pt0L d0M@X`ᔞP 0S <0` 060$0$Kp3c$84̙; 0-8@L ,"(ߘP0K0h3c4d c$JB04!`0<`0/hR \0R T0RP0/DR :80R -/P-//|fwt@t,@{f@~fvt X0- LP0@ 0 $LP$ 0 -@H2HL 6M040 /o"Q Rm X   B 40 Sr;;;X;X;X;X;X;X;X;X;;$; SR 0^PS KP` X `fQ010!80 @1pP" 0D^$1000 a 8୫^0a|"0`WV  PZeUP!0S  P  0S00(K R  R00~ 00 X 1#u@jcDjcd_> -p`L d!0 @H0*P09_,Pa(0 @b@jcd_>Djc -P`LP @0@ OLjc -@LP` ߕ\$ 4 < 08! : 0蜤@00SeL/კ -0LM 60P S@ `p`` K$KG@P `0 @`H0 $s@K"`pb` cLjc̤@ p-LTM@`T n|Kp0\K1 4 ) d x0@0S  \KPV| {C@P@ N|U  b@JB 0-@LK0h A0-LP@ 0SE@ @0 -P0ML00 S@P 0@@ J0S ` PpP?o2 T0S 0 00 q00@(K U\# L0PY@T  0 J@Ljc -L,MPUp- `A PU0 S#S` R 0 R,#S 0 0ᚦ P PP P0R S+ P  (Ky`V~0 0LK LKP g`P0V`00P0 gP0S K 0#PPLjc bKJB 0-@0(ML 00@@ @@@ \P0 0@0@ @@@NT$KJy$  0 "00#0#$0  0$KXJK0UJBLjc]JB0S  0 00/ @-@`p` @`p`!A`pa -`@L PU 00P@H0P00P`J F @ -P@PL `b6Q  ?""R0PP*  0-PP@LP0S0P0  R  K0h 0 0-@L0 0R 00(0,000K0h 0-40L@SP 4 w40,0S S 00 0008d p-LM@P` ᴓ耟0P 6!:(0 6,0 "K  0K 4 <(0 4,0 "K 0K0 0@0`0ad: 0 Kp @ -`@LH0Ap!P4!x  =0S60S50S 0S EppHnP Q 50S0 tԉ050 0 0 0  ΧP`0 0000( H/o6"Q R  R   0 0  \pPP #P 0SPU  P P q 0-(@L,0S0S00  <P0 0S K0h^ 0-p`PLUV,@U@1 ~PE`0JB -@lPLp` 0S$0C(@Dr R (0S $0CS p`Kh8dJB 0 0(`$@ @o0040p0 ,00000(`0$@ @ @ko0040p0 ,0\00T0(`$@0 @ @0Uo8dJBXjc( cd;JB$;y7B;JB -LdMQ@p0 ~v n`(KQf000 `P`Xp0ZPp_UQHA@TP @Z 01@0#@Dt0 Tp0P Z  W R, 0 P0 l 4 h K5 g K6 f K8 d < ` \ ( H0 T , L 0 @0 D q R< K <K <`t lK/6P  I@ GrpT P @D``8dCW >0W >C 0CW; HK8Wp 60W 26W+Xx V! Ĕ<80 ,8W  ;C0CW 0CW 0W' 0CW 0607W =C?0CW0@0 P7W 7C0CW` 70W 7W HtPud7W4 70W 5C7C 0CW80 0QS 0 F0 0A0CS…R6 pW $pGWP0PS0PPP@00=0S0Sh&0 R 501:S 00P0PW!U 㜻PP`puPPtr䀔`rsX }(K UmU w p1P o\P XrPpA0S~J4 R PP040/0S 00P&0S 0!H0 ,21L ,2qp4 pW9 P\$pGW  4L!,210#,2z0H R0S 0S l Pl00 @KP0 g b  1P>P0 @Kr(pW $pGPd0S RP , c$ `V0 PS R (`V $`FV0S  *P0A Q0X: ⇉PP50(S10S尺P 媺PPP 壺7P~0W S 00,0p0,0`0,0S  {q0,`p(pp1Ph1 rP 0S0 0(0(,0 P000P0(00,008000080<00S<0D@010D04Po00,0`0,0p0,0S  /q0,p`IUI PP040C  H< bkB@|B@tB@oB@kB @|bxb~f|flB vtfBK:KBXA01,!,"/ b0!,21 ,/ b//////0 00/ /H@o/  -L, -`L$Mp@KP1=0K@D\V\0P(KP& D R 0 B R@ ᒄP 0DSWP0S P  00C ^ R0 T R XX PU@0[S @KDH vH0S@PKCKB cd 0-@3L08@j9$0PU0(0S 3/XPc -L M8 ! K:c -L M8 ! K:c -L M8 ! K:c -L M8 ! K:c -LM8 c! K:c -LM8 N! K:c -Lu- 0-@PLP00S00P00C0b- 0-@L(дr0 -0pLMPK` @0 \0`K X医0P@ 0 0 000 0\` \?oP20S(K; 0-@L+(㕴K0hM 0-@Lj+K0h0/Q0SS// -PLTMp P P0P 08  0 0 <4P0,p(`$@ @ @9c<000<8`04P0,p(`$@ @ @`0 "c(KH H0*P< @ 00 )8 404 g;~:A;A4;GKBnAKKBRKB ;A;tA|; -X`P𝤀0 !`!800 (  , ! b$cDcHc// 0!< 0`4 0 (   !/ b$cDcHc 0-LP@K0h -LP pYf@0@TKh00S `3/adX@c -L@P(p`& 0R7P+000\U(  ) 3 000SP0PP00P -PL@Uy2`S 0C8C8S25/o0S0(Khy|b -`P嘐LYp屹@T 0S0000C0容KT%(P 0 03/03/d -LE h0 ;4A c$< -@L P0 P`0t LH`@ 80P KhdjcXKBjc^KB c -L@M 0K #0,(TL$  a 00S  Kt 0,p(`40K0 K`Pv0 0 0!0,p(`0$ 40K0 K`Pce`@2S ?S =<2@2_S@2 M@sh@R P(Q0x0,1K0 -@`P9 L(1 902U(00Khx0 L jc0P/ L jc -LMP@`p0(x(Q0,1;PLBT D@DTs K8K J)8KPH@ -LM3@03cNp`LRU DPEUI< PP" 0S00P00C0&0K |0K`HP,0S 3/XPUKU x20Pc -LWM@._K&~`!`   <  P3"0 3Q  @" R<<"@7 0Q$P 0?S@ Kho#΀a L0 0WVp `\` 0@\ 0@` 0\ '\0` `0\ \0` `0\ \0``0\ \0` `00\\0\1<\13# 4P"3 1P1 3P!3. (:0(03PK31@0`@1^N D! ! ?$8 |2M8 |h X"|a0 0 0PP0@S?P SRp @? p!`P @P$P @$rSPPiui iiУbii b0Ljc -0Lp0SoCP @0SLB @2S oCV0 R H@T D@DTP 3 P 0S Pd; -L@`P@P  -0L`PU_Ep @0S@RU _EU3LB T D@DT 0 0R H@Q Pd; -L@`P@P  -LX0S !S* 1S  Q(a 0PU` `Đp_EU0 SLB @RU _E ,  H@T D@DT 0 RP  0 Q:V` 'P` c;d -L@`7P@P @K 0-L@ P0RP0K0h -L@`P@P  + 0-LPx0@T/Dl 00SL2 @BT /DR@00S H0S D@CTd; -P`$U00 LP0S@LBT D@DT&  R0S P Q P  0S*p0  0H@T@; -L@p`P@P  -PLM`@pL0S Q P (00 KPP (0, SS  3/0KK< Q0-LP@0υ0 R R& Q A PT QG#1^8C8 ^P  L0^H  D4uFK0hQ 1KBKB8AKB -L@`Np<0S$KkFPF_oSRP<`U` .PU 80S 3/XPPU 80S 3/XPc -PL@op밀\0(10``V 4F$KkPd -LPpH@X` 40 0 H ( pLB $KkP H@T D@DT  Q H0S D0CS0L2L0S d 0-@L * K0hf 0-@L  K0hZ0P/  jc0 R0/ c -LP 0R; 0 - 0 41<0R4"@ L(R /.\1`1 D53,p  CP4 ,5 D `@bCd{W K0000 0X@ KIT \0SK@P4 K}P K4@D03/@q@P 0S-@ KcPP@ 23` 0oK03/@P #` b@ g@30|#S 7p#S d#S X#S' W6 0 0  @P, Ko#S# S!"S "S""S "S$ &6 "S }$'- S q" R3 1 0 3/P@) 0S-@% DB0 Z  \⯦1$Zg p$@ 0 4/!@⠦NT 0 0 (@04/@#10#  p0[T00S dA pW \wW3 $03/$!@l0S  u 0u d S*.hR SO  S, _I SF *.SB 'BO BTB@}B@&iEcDcFc@>cyizidjc;iiiii{ii8iui niiiϖo@Fc>ciiii -LpPs0`@TOD@BT ODT 0 S 90S,1 0{P0 nd;jc0  djc0jc -pL`@PP 00S0 P @P P KBLB 0-Lë@ 孫0; 0-@L 士K0h胫; 嚫; -xLCMQpP@ X1Q -`H!   `P TU `k5V `(K P  0R KLBT1` KKKKK`PW14 T0W -`D@DT 0Q H@  s41i i b@[LB -LM@ pQ `V <[% V3 $0K3/ PNU+ 0S(  Kt KtP`@K0S  %t  00S  yt ut$K+AP`PFc0/ -`QL@P  0R 0007P' 000SPPPP000 0R 7Pe000U`0SP0PP00P 0-2L@SP K0h/R  0$K0h/ 03/P0iXi#08Q AA@o// p-LM2PS@ 3/Kp3 !j`V 0# R3 L KR@s0IK KX3/PV3`&c R L KR@msIK0 K3/i 0-QL@$P U0$0 00ES$0P$P0 0-@PL "P ^0 0-LM2@SP 3/K0K0 K 0-3L@A0@S AS S0 03/0|2S 3/4P00K0h/ -L MP30 N0 SF00t` @ 04D#D0HcS$Hh40S0 (000<40pT0 (00KC50ß T  T0K  0K0 KQP * fP0 $K0 3  ,10OyP  ,Iy0P<<0) 0  0 0:00p((#  3  ,!0 #yP:00 0 0KD P00S ` @ 04D#DH$Hh20S 0T T 2TA 00 P I0SF0 4:#:S?0 <@04D#D1H$HT TP000  `0 0:0d10T"VP1T+  T@1@0T 0  P_ (0S %0K %0[0C S00T 0T00S002B@T  0R000 00  R000000w>#dbGd@ ݆:c5Уb:c c -L Mp03K3`A0ASP0 2@  R R R c/@0P_9RE R ,Kq@ $Kq0 4`0   `$Kq00  03K&  02K^0"0K00!0K0 0K00K00$0K0 0/@P #T@K3  0P3Kg@*@PL 0 $4"48C8S 0  $Kq000@ ă@ 4,48C80CS=13K3[0S( )04 3K5 #RH L0S0P 0 0 70   x$Krqt1  h12K0"0K0!0K0 0K00K00$0K0 0@P @Z0 0H  0C S00S 00C000000S%  $K(  ( 02 [ 1 [  0qT ,K ,10&q0 0KDN @PT0QP @M7@ rLB@33 -P`@LT SwP MwP @ -QL,MpH 0A!,21P ,2@KNPPT@ 0 80S @KC00T P,"! ","(KH0S@K2\220H0 b?\2V |  X\bV@K`0XBTjH0V 0  H0 ?@K 00 p p@0L0 0P0H0P@L b\00@-C0:PH@R 00 C0,APA Aꫪ$@ d 00-800:00@10 L@$0000%00 %Q 0 00#00PXRlRp2{H0R41<0 0(0K0h/ဖ6<1<@d 0-@|0L0t0003/XRUiRQ00S  0 堟\20C\2X25d0<P/  "010""#010"2#@00@-DPP0/@R00# "0\Qp@-=@0S7p0PC U AAQ09S0aCQ 0C70C000`A V PAPEU >9QC<aPAU A7AA00 \0S?p-0C0 S3 pp -@LPT` T% TB {o  0@H  po lo0@0^0@00 0000000S 0S 0S @T PKo D300000000000/@@@@ p-LM`P˞@$ K,K`P&,0[- $0[* X"$K,KP 00 0 ,Ko $K o0 0X24`0SX2  0XB0@\20\2T ᖞKp` p-LM@Ph$ K,KY`PX"$K,K@P 00CS 004`S  0 \20C\2hKp`|// 2-QL@`P -l2Qy `2Ql X2QX  Kh+82Qn M0Q`2 Ÿ2 0\00-\0Sv4P3, 0Kh/1Q 2?5Q1`20d201Q* &0Vt"RA 0KhU00S00Sn.3A AR 0303/P PKhP2!4<010`" !d"S d2KhKh:x"R0Sz 0 0 8ktPoi1iii2i(#iX8i(i @ 0-`2L@ d20d20 APd20d2000 0-h2L@S 0d2 0d2 APd20d200 0-L@M (00@pl!0$PK@%0 00,$@ @@ @p`L 0!@0,(040$@ @0 @0 L$KLB;0S 0U `,.% 0 3/`,%V @K bLB,@(ddc 0-@DPML@ %0 0(0@@0 0ᢣK0(dLBQ 00$&/d 0-L0L@0S 3@03,0003/p900dd 0-@LQ0  R K0hkx Q#S #` ( 0P0\ [4P0S 0S S /00iϖoiX W< -PL` @0 $00000|00030U:0@1`0@PP S<0 0`(06/3@03ꘁW"0000 ( $#0 0  -@LP`p# 0 0  \:00 Y0 0A P L `0S: 0  000 @ ``A@ -L M4bpP0Wp@R W p(p(KT DI` GD`PY*0U ES 1 PEU WPPW B[aP 0 P p  gPpWX0fP p  0 0 0-@L8/B4048<0S0rK0h3Hkc -Lp`P2XP@PG`P$@0S @P 0 0R  2`P * @*i40 H0LPD@ TL@T H@T DDP@@ -,0LPS`(V @P0Q  'P@! 80S 3/@P 00,@S 000VY ``WWY0 V 0@ \ 0-@LP0|P 400 C 40d 0-LP:P8^AK0h@@( 0 PR0ĵ00 K0h[@kcHkc -40L@ 640| t`tPPU`d0P`@10BL`@ƧhD⑩kc@kc bkc 0-<@40L@P6400DP0T0WK0h@kc -PL@[0P 000P c40P %p`0f0 &WV&ā 0-@PL8M4 HKY04 HKD0 00@0 0<0 H0S(1040 L0000 0 K0 -LMp`PU@PP000 00c000P    P@P  }Y0` 000 @D0R 0 K ckc@d@,<OB@fA|b90"S  0S  R  3/*///-0"SP P P0 \0 ^.0SV**T @ P"X0- @L08H00 00 p-@LMP6@x0S L0S 3/H03/ Kp0Cx0[@0`V,6@'  4K0 4K{x00Cx0d@X~ 0#K܃K*X~L~܃K)O~,x0SL0S 3/H03/0Cx0,d-  0/ -LM`PPH 8 90R 000(@ IG80 S00000 09p0  p0  @0 G@0  G? G`0,@K\p1d0<0} !}0 (K,d p-SLMj`@RP,K,@K,Dl1 03/@,Kp 0-l@LP@TPK0h0U@( j=HvK0ht,dA|b|< -@LMPU`4 0 ,K[ 0"S200,0K֋`! R  ,KF 00"8S,200,0KQ20S 0!0㵋`V -9Hrr9K R$ 03A0AS 0 0 ,0 ,!0 0,K 0LaRb`J0$! 9 R%0000S `,pK `p0 c000 0S0 0 00RT00S `,pK `p0 0> 0 090  0 ,!D0  ?PD00 ?0#P @<04@S3,! >` ,0K!c ,   4 > @>(K c|bASBDd@d -8L@`p(u1@`p`$Kk)u,d 0-PL@U0 0T0 R08 #804 0110 K0h PL  P   4T@HSBpSB0 t 0 R/0Q -LdM<`p 2@   hKP=!Wh`K$K&K` @\KR> @KN>#1 `V :P(K\K@> 0hK3/PPXA 0P d$LpTp@T0@D -p80S!<0  S S Rd|`K X0S X`0 :/։Z   4@T 0@DT WU  d P pHdx clc -80L@S0P S0PPX 00R0Sx` 0pp0L0  D@8/P0000`0PS404@@@$PHdlcx c\ `P/0 !`8 0 0 (  , !/ b$cDcHc 0!< 0`4 0 (   !/ b$cDcHc -T`LPUՈ@@8/ @ D|0PP0x clcSBSB -40L R   Khx cHdLd -LdM"`X2P pPK @<!> JK3K4KP`K,= :K(=2 `V  G/0PK3/PPA` 0P  dxKL`T`@T0@Dt@U \0d@TaSJ XG `08/ xK(K80S"<0 Y S Rd0dK 0 ωX0S Lj`0 Xjl;jlcHdx c L-L<` 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@1 P//8@-@P!-7-8 -@Pp'LM l@  `08 00CS )x<:0<: /P0010#21Z 0 ?Vpas'd"0&4/` 0@` p0SR"0 /!0/)]  0 9x<:0<:` P)=00 SZ0R70)'x <:0<:1PC P!:h0:`1 p`$p`YX R00x <:0<:1PC !:P0: pW *R R `:S 0)w<:0<:VpPUt  0< (K S 0 0)<2f'CYB?ZB\ZB@@ZB ZBR*0S A/ -Q*  @p@-Q @ \@0 SQ00@p0S @`CPUT C @PUT0\00p^ PL_UQ @A,à0@ 0@ 0@ \\Q PAQ Q 00000 00@#1 2 /UUUU3333 @-+/ 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00x+ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/QC-Lß0 B0#01 #R" b 3R @@ ^0&'" 0NS 'Qr#S Ÿ 00#01R #  Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌ , , ', q , ,Ġ  ̌   Ƞ ̌ q ̌  , , ', q, ,Ġ ̌    Q00## A#\#4 0Q<1   GL@ -L M0@R(@K `*RP3 R$ P* P?R% [R ^RPpp P\5 ]\E R -\= Q`[R9 ]V7 RP PP0 KP 00 R 0Q p P P P p`0SWp @/o"RA-p"@(@0!!p"0NS(1ឃ!Q Q Q '&' `0@D4`P8<""p"TPN0x'0t'[ -L M@ 0Kc q-K 0-@PL $g-@ (- 0"0P@ -L,M@@p(0<0 0P80 0H D0 0@0 H0 0KE-00(c(#"$ c$"<0 5e3# <#0@  p  "06f1#f+#808@W0) 00#08D 0D  @W<H qh.ɠ,D <L .P PD', Šb,p,p'pL< @c & !c 8@ 8 pH@P 000 ` 0` 0 00p0p 0 P0P 00(K@ 8 P`tP` 0p@ -L M`P@) $(pQ ?PU5  08R(!)8 b;, `,5P(qᜀ!(Kb8"P#4b4# (0 ,Wh !, K@R )@ b,8 8  ,0(0 -RLP`- ? @p`Z(: U,"(J` p ((?WH? *3ᒣ$T  (:,A7,A"" @pG@ %, " @pG?WH ` 0-@PL $,@ (+ 0"0p@ J 0-@PL @ (+ P+ 0$$0@ -LM@ `#K v%K!&K!'K"$K"&K#'K#(KPP 4K+K3 0D@ ! D @܈K D K)@(D @ K !K K 0܄K&KK$KK 0K  ! 0K<08 `#>20 ">< 20 80ԊK?"10 ?8 "10 *K)80(< <30 <8 30 +K " 0#$K܆K%K " 0#܃K K&K܅K %K " 0#܄K 0ԇK 0V%K&KK'K'K(K  1!0 " # #,kK3  1!0 K`& p'   "# -#3p0  0 KhKlK0`& p'1hK`t `piKhK)K`& p'0ԇKhK() L0H #790 "7L  90 "9H mK70 "9L 70 .Kp'H0`&L ;40 ;H 40 .K "0#dK$K 0`p&KgKdK` p0gK`&p' 0`p` 0 0KT0P K#>20 ">T 20 P0oK?"10 ?P "10 /Kp'P0`&T <K31

 0 K  0K ! 0K!! 0K!"`p"#K 0K## 0b#(K&K'K$K&K$K$K%K&K#K%K%K#K]$K&K$KK$K#K%K%KeK#K@ -@@LDQ  PUP`%  0pRPQp b)H *@ *KhR Q b)p p )0P0 -L MR@: @ ` ZP : ) 0#K$`p #0##K!#K0d $P J  ` PpG p#)Q0`p## 0d $(K$ 0 QP$pGWF0#ᓢ%U  P)Q )$ 00 QP$တIY F -`PLP =@ @@T ( 0-@PL @ (P) P( 0$$0P@YT -`PLP @ @0T ( -LM@ p lK&)p0o00 p000 p000 p0 00 p000 l0c$c\0 0 ?   "  "h b`$`  "  *    db`$`   ! `  )`D` n!@, @ @$@\ꝉjaa  " X (M iaa *  .T 䍈dAbb,  P P)Pbb, L  P%h a$a$ P]  n( @H !bDb,  DeQ .lDl  `@% "@@@$ nDn - a P< *͌b!nTn! )8lA쭊`T` "t (4ꝉjaTa $x  .0 鍈bTbl |  @ i *P"  P%t  ,P%/  h) " "x@  "/  ͌n "@(  "|@P! "/ @ @@l .@$P @$P `@$O@ P@,@00 @$ "@0 -#0ap .0p'M.;b!P pP`!`&,tP}dA,P,ϠP`Pm xP P P"P%P唀gq$!|*]!!  fa' ")孊 " "/@@eQꝉ@$@$@$O@ &@p (@pj鍈@$p@$@$O@ p%@` p'@pt`i}@$`@$@$O@ ` @*@$`P@x`PhMP%`P%P%_P `P)P%` |`tPgq䭊P%` P%P%_tP t`P(P%` `xPdAꝉP%`P%P%_xP x`P' P%``|Pj鍈P%`P%P%_|P `$Pp `&P`pimP%tpP%P%_P p*P@p'Pp@h}@$P@$xP@$O@ P)@ P%@ P@$fa @$|]. @$O@ 删@(@$ @嘠gq ) )M, )韠ጐ &*eQ .䭊. 堀'.`t`dA,`,Ϡ `% ,`px`jp `͇  ` $ `PP Pn!|P!P! P* !0@0l@ "0P "0 "? 0   0 @06`p@ @ -@$P@$P@$O@ @pp@aP@}@@.@$@$ PPt@b! ` @.͌@$@$ ``gqmxP P%P%P P Pl 捁|tP!P%P%t   tfa  .! 蝉!/x x h p  " " "/|    |i  ͌" !t !/   n` -@!@$x@$   l p⍈! | ௠ pp b!`! p}   ``hP`!m   PPgq  P]@!t@$ @$䟠@@@ @ faM"x ! !/   eQ   "| " "/    dAp - . . a` ,,   b!PP͌ P   PPn P@tP@ @$P@$P@$O@ @@@l p.00x0p'0#``,0#`&0#?0 `0 p|t }h " "P  "/t  x `yZnܼbm" P%gq!!/x   | @(@$ " P] "fa "/|  @ " M!t !/   '! "eQ "x "/  & "pdA%* | - ௠`. a  $P,Pb! P͌ P  P! P@@tPn@)@$ @$O@ "@ )@ l!x@ .(!@`!@ @ p, p' "|@鍈i "@ ` `& "/@p@}h.@P)P%.@.@ `@mgq,@,,Ϡ@P@]  @( @$t @faM ) ) .')xeQ䝉 ( (,Ϡ&p(|tpdA鍈 p'ଠ p'p'`p% p'x`pim !!P $!P|h]! " "0/0)0#@@p0M@0Pp0P0fap0`0p0 0 p0(K000,00(00$0 0 00000/#EgܺvT2 -@P1L00>! "0%?0 0%0?S`p @p` #?0S: EKh#@p -LMP@0$`KS  !1" 0S xpp0~? S U 0 # !1" 0SK %[B@0A0C,ĠCCCC R/ G-p0HM008 4Q 0Q <0 @R 8ȟ0 p 0%00#0 <8 $! a@  $ , ǁ  #  " 4b% 0!00#p0<, ! pa " ,$pǁ #  "(p b% 0!00#,p0<, !0a4p)NON " ,Pǁ #  " 4b% .!4 ğ ". xğn  #, \ğ$ 0!0# 0@ğc> .!$ $ğ ",0ğn  #,<#Ď  0! 0#0#c>  . " *,! a #,,|ā0" 0#0dc> !. H*,!0a #,ā0 .$0c=  *  b+) ) Ł (00c=  "0 \b+ (@  ,(Ł0 (p0c=p p'  pb+ ppp'0P3 : L?0V FKh >@P 0-@PLMK " !? 7R8 bx b8K  X K0h= @0@-@$0`( "$`T"a! 4a# 0 -P`8 `#T0.p@L`T%0 (0D PD 0Dd0P00DD0D`V@@p@%Td-M Ѝ@- p@ P` !LN( !@A RC/A 0\R#R! R/ -`LpP@# *PP @  [@P 0@P0W H0W V@`V`T@yaratcid -LM0p14a@] 0P 0P V`<P@ ` 0*K.P0! <.`PP *`P 0(ἡK& byaratcid p-LM@@@P@`T:Kp0 0` 0  BY]B]Bc0 vyara0 6c0 mtcid0 6cQd/yara006cQY/tcid006c / z/ 0-L@PP0 0PP0tcid 0-L@P 0Pv00loob -PL`Z@PP  P"  0-LP@ X0P 0 P P1 08 QPrbmn 0-LP@ X0P 0 P  P 0 P0rbmn -PL` @PP  P  -PL` @PP  P  0-LP^@< `0P 0 P P 0 0 QPrbmn 0-LP;@ X0P 0x P w P 0 P0rbmn -PL`6 @PP  =Pc  -PL`. @PP  )PO  0-LP@ `0P 00 P/ P^ 0e 0!QPrbmn 0-LP@ X0P 0 P  PH 07 P0rbmn -PL` @PP  P  -PL` @PP  P  0-LP@g X0P 0 P @P 0 P0rbmn 0-LPi@G X0P 0 P  @P 0 P0rbmn -PL`d @PP  kP  -PL`\ @PP  WP}  0-L@!P $0P00gnts -PL`"@PP  1PW  0-L@P $0P00gnts -PL`@PP   P1  0-PRL@ @% 0!P0/@oA0@-PäP P P P0tt@L\PDT\\ \ \00P0\:$$ P000\0SNP0T0NUT:xx0S0 -`LDM @PU0<0 00<0 0 S S S|=x=@0 0SJ  @ dPP@= Y0J"@ @0 pU0pSpW8U &K080 <0 ` P40 Hp Dp <00SL0 j <0000 <0 L0=S *S :S| 0 0S0  <`L̠   S3"P% R0@0CPE08`p S>03P05@2 U *00J  @ d@PP U< 3 @ 5@2W0  4P<PQ0<0 8  U8 4505@2 X,p4 <` <\40<S P U>0305@20 0RP0(K Q* DQ'R0@0CPE08`pp S>03P05@2 U * 0 @ J40 #d40@WP @ P U50@2`P U50@2` P< 04 < 4 0A P0p 8p  D L0bSR fS FS@<0000 <01 A a>0 3P 5@2 U *0`0J  @ c@PP U< 3 @ 5@2W` b 0B0"!0# 0 00V 3 "R' X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ xc@PP U<03 @05@2W` y4 P<R00SH00< H0 D00 UD0 405`05@2 00 0C40 00000 0Sp,040 X R+ 4 R(XH @`FD PEp0  p R> 3P 5@2 U *<0 0`0@ J @ 'c<0WP @P U05`@20 P U05`@2408 P<S  RH00< H0 D00 UD0 405`05@2L0FS 00 B< 8,0p40 0 0S0 80 00<0 ( 0S: <0S7XH0@`FD0PEp00 0p S>03P05@2 U *0`0J  @ b@WP @'P U405`05@2000 0 S0 40  0S P U=03`05@20P U405`05@2 00CSXH0@`FD0PEp00 0p S>03P05@2 U *0`0J  @ b@WP @P U=0305`@2&KJ @ xbP80 P U`@0V00S3 0BV):XH0@`FD0PEp00 0p S>03P05@2 U *0`0J  @ Nb@WP @P U`8p %#038p 505@2,040 P U#03050`@280 d0RL0=S. 0S8 0CS5X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ b@W<0P @ `40 P U=03`05@2 00 B< 0 0 S0 80 0P U=03`05p@2 0S+ <0S(X @pH0`FD0PE00 0 S>03P05@2 U *0`0J  @ a@WP @*P U805`05@2p00P U805`05@2<0000 80S&KJ 0 aP0P U`@080 0 `80 <0Z8p ` PIL0FS080 $[BBA 00-LM@0@zK0/ -P`L@ P -p-PL`@ PKp 0-PL@ DP0 -p-PL`@ PKp -`pL@P P -p-PL`@ PKp00/6c0-P@  P 0S RP0/P0    PP0/0/R  0\/S/ --LM 00S n` Kd@-p@ / ?!BC  @ 0-,LS@P 00 000d\@ 0-@L0P fU0d P-L 0R ,0QPooA 0- 0PSL@HK0h P -P K0h0[B -Lp@P 2P`P-@>` P 0-LP@P P0 000 -PPL@ l0Rp@P 0000`P0Q`\@oA -PPL@ T0RH@P  Ǚ`P0Q`\@oAP/ 0R /\@P/ 0R/\@ 0-@PLP0 40R ╙PP 0Q\@oAP/ 0R0P//\@oA -L M@P` K?o 2Q0S0S P 0Pp^P  D0R S0 ( _ PP k\@oAA -L M@P K x0R`B PPp-`P 08 S0( r_ P`P =\@oAA0P- ?o, 2^0S0S\@ P-L ,0R 0Po\@oA -LM$0pSP ``V`$0K P $՘@P 00$  0KP 0$ S K` (P 3P$0@ 0[B 0S/-S0-S0>S/00// 0-P0L@Q 嶘P00< 0 P0 0-PL@AQ0P0 -@`PL 0S<P P >Kh PP 0-LP<@P /P P >P K0h0 -@`PL 0S<P P /P >}P Khv sPP -@l`lpLPAQ<Q >Q &Q 8pPO[B[B[B D0-L@^P ,hP K0h90@[B (0-L@wP0K0h([B 0-L⼗@P  㷗PP0З@0,0 0Ǘ -pQL@P b0 @ R6" <P0 R !R -R E/o"-Q R00P/R>PEU0S0(0 ` P 0B0S<300>R/R)0FW0 S P0/S0P$0(0S0$00>S0 >S0 000 0P(PR`0S  0@0S<3 P   0@0S>300=P00S A 0"Ss0 S 0m "P  C  >Rd00P ]P0Y0@- PP0<P8 &P @aT@mT!@pT2@;T/Q ^**lT'tP";P<tP;P>pToPsP ;P'SU00gT qTuPoPtP;P" Q-L o p-LIM@IKU`P R PK?KPJ/KMKIKmP Kp0 P  PP,1 MKIK(Q5/04a  MKIK3/P4101  `K?KJ/KKIKIP0 41 0K,1IK(Q5/P 0141 @ -L@,0PP7 `p@@ 0B0S 23 ?P&@<R P  P0>SSS DP@@HP @@[B[B[B -LM0 IK0a00S 3/@0P P U 5/0K0 IKPK0KIK03/U` 5/V  V Vp01(1 (Q00S 3/`0@ P T 4/003/0JK03/P T 4/h p -LPY@PP PPᦕ$0SP 0` P P PP  `PxP[BwAP0/ -PLJM8 IK< 2U0`0~K8100 00RP P xP %P PP 0  03/P P PT@@ A 0-@P@L3 0 0 0K0h -@PL 0R@ p`PPm@ 0兑ᅡ   0兡 0P 00U:000@ 0P-L $0R00P   @ 0-@PL000K0h1 0-@PL ,0R@P@ 0@ -@PL` H0R@ P0S@#*W@@ 0-@PLT $0R@@0@ -PPL x0R|@`0S pW`@ 0VpP `@ -@PL` <0R@ PY @@ P /o00"\ R00\~/@ -LM@Pp 2R0 )0 K)PP @ p P-(0S A婙i`P 0Q>PP9ՙ `,V <V VP F(KIPP h `<r42`P 嬙1v`壙V P U` 0080 < P80S0C00 ! 8 0` 0p0000000  E@"B!# 00 0a 00 1 pP@6c=ddddd@ -L@TP`p tTb00 1P V0 $Kk)M0P- ?o42 ^0S00 S@ -LM@P`) 0R%P<0 K9P 0 p`  C! 00C0000 uK@0P/?o( 2\0S/00 S/@0P- ?o, 2^0S0S@P/ 0R/@0P- ?o, 2^0S0S@ P-L`Pp@ @T P*  0 S @  S@ 000 0  00 0 0P @ 0-LP@PP P僎P00 03/P P P -0LpS@P =`P $Q`:0PH `KhT@ 0-,LfG@P 00 000d<@ P-L 0RR o 0-@L0P H0d - 0@SLPp,KosPS  `LVV)0,Ko 0"!0 @Yq#1 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/ R.0 \ B BѴ Bôr- B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@@t@P B@@P B@@P R@/ R/ R Ѥ ä/-\{F ,DP`pL%T\&dl't |@P`p B RR,DP`pL%T\&dl't |@P`p R/ RAn,D R L@Af,HP`pH%XX&hh'x x@P`p B RR,HP`pH%XX&hh'x x@P`p R/ RA:,H R H@A2,LP`pD%\T&ld'| t@P`p B RR,LP`pD%\T&ld'| t@P`p R/ RA,L R D@A /R Ѥ ä// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/011/ -pL@Q`P {P `P10r 0 P 0-L@\& ^ QRS  T00{0LQ R S "  T  00 0 -LMQ@P`pW Z ' 0yZP@ R[WPZ @0G Z 0 @g@Oo@d8D o?oL\Z 0  l>4L4 00 5 N04P? ᮏ0<0 080 奟PK /#K R 0\@4P 0 #K 0 Z@P(KW30B Z00 V f`oo`f56 f0F00 140 #K@Po?oA! \4p  \ @l4>4p 00 5 D@l0@>40 000 5Do?oL\ 0 \#K0@ @ l14L00 5 AQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /~-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ -LU?<\B 04 8 < S $S $S /T S $SQ 0/Q 00///PP 04 8 < S $S $S /h S $S $S//Q 00/Q 0// 0-PPL P 0S 8⩝@P [8K0h蟝@0M/ \B1M/ < 0<P   /  b8bj) 0-@L㓧0  0:0媧0 0-@Lェ0:0K0h蜧 -L$M4 @R (  RQD 0    ,0 <   PUY  0 RL0< 00400_ 0R010 0! R!100Q0;SPU  $1R00$1`T 0`R00 0R010 00C 0D01 I UjDS(K0 AR@0 080 pW( 0  R0 4  P00< 00040 00R010 @0 0`P80 0 00P!00 <0 40<0 ޛ040 R00 0R010 V` 00C 0 0PJ0 C\0@C^)PpS, @ 0 @ 0 , 04ΝV `v^y80080 忝P\ 0Ac4H0 bH08 J 8 @ 0B@0 0 0 Sq0< 040<0 n 0R00 0R010 V` 00C 0 ៦2q02+ A 0@ A 0 80S  @ 08 @  0 +40U0000<00B00S0``0`0 0P0 04804080 040 000 0@0J0C@0 (0 0CSP pWpPV2`PxP^+ @`p`@a+4PP@0 `8p 0S0```PD0ǽ긠c -PQpL`{PW@A0d 0U00 p` P P #RH LQP\ AV|  R UX RQE ` .\PRp P@Y.YQE>XPP PAPEU PAPEU0L \ P 0A0CS00L-\ S፜@ALX0 0PEPR.\p QR0 B  md -`p@LM |PK.K" .L`K" ."`0K <<KkA -LMPOK( pwK~{`PV T60S H60S 0I2 0Y0K?K"gP ,1" Qp;pWER* U*wK(K K{K  Ky P yP 2[S 2[0S 850S  .kKd"%k?Kn<0S 40S  .kKS"0$0k?K[K00 8P 2 xK~H0IK( ,1 {?KKK LbbAcb@AHAAޢA*AlAAAAb:cbl* -L0Mx%xE,22,2tzl%D?"kf5(|~z=] *=@}Ekw{$$뤇+m?둰뵙뮋cm^jqfDD$*x4K < $*h4 Ri IvzS~tz *T  nnWz놆z뷾0  08S=9r닾"i[? 3S )40040)U mpp3p$B?@!KX)`n뗇np)9~r떮0" 00 0 BfPb,} i}qzw'rr圂i[PX 8000h2 SR\" 9 { }$K<< A<0唀X 4}pP 0} |0Y 0$}81E 11j0POpWPePx!xx=LPpC|`p@A}siS@1eDKr4K#KKP<0, 0CS0X   |0pW|@U0 " 0 P00e0i P 9bxXd@Rc bbhb@tAJcKc2A@Mc?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_LB>C> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    o p p q Pq P25q l6Dr P25lsllsrasrror @@@oA@oA@oA@@@P@@`@oA_M@@P @ @@A@ @@P @@!@&@ *@&@.@&@ 3@&@7@<@?@<@C@H@K@H@O@H@T@H@pPX@]@b@f@pj@n@pPs@]@ AU,A AU,Ap x@}@p 0@}@p `@}@p p@}@P A}@P @}@P @@}@P P@}@- B@@@ @@@@@@@@ AA `AA@@@@@@0 @DA00@DA00@DA00@DA@DA@DA@DA@DA@DA@DA @oA @oA  @oA @oA @oA @@@@@@@ "@&@ "@*@/.@@o1@@0/@@p 5@quA:@?@@B@?@G@K@@O@K@T@9AZ@9Aa@9Ah@9Ao@u@y@u@@u@@u@ wA@ @@ @@@ `@@ A@ @@ @@ @@ @@ 0@@ PxzA@ p@@ @@ @@ A@ @@A@ @@@@@@@@@@@@@@ @@0@@@@@P@@`@@p@@ @@@@@@@@@@@@$@(@-@(@ 1@(@05@(@@9@(@PaB(@`=@(@pqA(@A@(@E@(@I@(@M@(@Q@(@U@(@Y@(@ _@c@ g@c@Ak@p@t@ y@@0CB@@}@@P@@@@rA@@@@@@@@@ @@0@@@@@@ @@0@@@@@@@@@@@@@@@@eqnecsccmiplvsvchilsgeltgtlenv0.01.02.03.04.05.00.510.0edeafdfafafdeaeddaiadbibpmzsdepoAoA@@oAoA@@oAoA@@oAoA A7A| | 7_bus_dma_busaddr_to_paddr@@@@ @.@A@V@k@y@@@@@@@9B@@@@@@@ @@@!@@.@*@3@<@D@N@D@W@^@h@^@p@u@@@@@@@@@@@VA@4^>2PVA@4^>2VA@4^>2AVA@4^>3VA@4^>3 VA@4^>3pA@4^>3qA@4^>3qA@4^>3qA@4^>3qA @4^>3A@4^>4D @]>4D $@t]>4i ,@4]>4`Rf4@4^>4 i :@\>4qAB@4^>4TrAJ@4^>4TtAR@4^>4TtAg@4^>4TA|@4^>4T A@4^>4TA@4^>4TPT@4^>4T`A @4^>5TE`A @4^>5TE`A @4^>5TE%V @4^>5TEWV @4^>5TE i@\>5TE $i@t\>5TE0$i@t\>5TE ,i@t\>5TE0,i@t\>5TE .i@4\>5TE0.i@4\>5TEAi@t[>5TE!i@[>5TE !i!@[>5TE)i@[>5TE )i!@[>5TE-i(@[>5TE -i!@[>5TEAi3@4[>5TEAiA@4[>5TEAiO@4[>5TEA ]@4^>5TE A f@4^>5TE`A q@4^>5TEJ`A }@4^>5TEJ`A@]>6J`A@]>6J`A@]>6ZK A@4^>6KPA@]>7ApA@]>7AA@]>7A/A@]>7A?A@]>7AA@]>7A/A@]>7A?A@]>7AOA(@]>7A/A5@]>7A?AC@]>7AOAQ@]>7AA_@]>7A@Am@]>8A0A{@]>8ApA@]>8ApA@]>8AA@]>8AXV@4^>`A@4^>XV@4^>?A@4^>@XV@4^> A@4^>@X/V@4^>@@@@@@@@@ @@@@%@,@3@:@C@L@U@^@@@@@ @@@@%@,@3@g@@@:@@L@:@@@ @@@@%@,@3@:@C@L@U@m@^@@@@ @@@@%@,@3@:@@@@@@@@@ @@@@%@,@3@:@L@@@@@@@@ @@@@%@,@3@:@C@L@^@v@@@@@ @@@@%@,@3@@@@@@@@@@ @@@@%@,@3@:@@@@L@U@m@@@ @@@@%@,@3@g@@@@@@@@$@+@2@@%@,@3@g@?@F@M@T@@@@@ @@@@%@,@3@[@_@c@g@k@o@s@w@{@@@@@@@@g@@@@@@@@@ @@@@%@,@3@ A A A A AA A"A 8AYA jAA AA AAdata_abort_handlerbadaddr_read@````` ```pmap_map_chunkb   A( A2 A? AZ Aj Ay A A A AA AxA A AES-6600 q  !!!!!!!(!!AAoA@ AAoA A'AoA8AAAoA ARAoAcAlAoA}AAOAAAoAAAoAAAAAAA AAoA#A,A=AAAJAoAAA[AoAAAlAoAAA}AoAAAAoAAAAAAAAAAAAoAAAoAA"AoAA3AoAABAoAASAoAdAmA~AdAAAAmA~AAAAAAAAAoAAAAAAAAAoA"A)AoAAA2AoACALAoACA]AoAnAwAAAAA@AAoAacAAoAAAA!AAAAAoAA AoAAAoAAAoAAAoAA&AoAA.AoAA7AoAoA<AoADAoAoAMAVAoAgApAoAAAoAAAoAAAoAAAoAAAoAAAoAAAoAAAoA AAoA@AAoA$A-AoAAA>AOATA]AoATAnAoATAAoATAAoATAAoATAAA AAoAAAoAAAoAA AoAAAoAA-AoAA>AoAAOAoAA`AoAAqAoAAAoAAAoA@AAoAAAoA@AAoAAAACAAoAAAoAAAoAAAoAAAoAAAA$A+AoA:A2A>AACAoATA]AoAnAwAoAAAoAAAAAAAAAAAAoAAAoAAAAAAoA/A8AoA/ADAoA/APAoAXAaArAXAwAAXAAAdAAoAAAAAAAAAoAAAAAA*A/A8AoAIAQAoA^AoAoAfAoAoAAAoA AAoA!^!ԃ!D!!^!ԃ!D!!!^!ԃ!D!!!^!ԃ!D!!Ԥ!!P25P250!P2547l63P25AoA A AoA A@" AoA2 A@8 AoA? A@C AoAM AR AoAc A@i AoAy Ai AoA~A~ AoA A@ AoA A AoAy A AoAy A AoA A AoA A!AoA!A!D!P!4!x!p!P25!D!!!4!P2547l63P25!l!!oAoAoAoAoAoA="AoAoA!8!!"""P25!8! """P2547l63P25oAoAoAoAoAoAoAoAoAoAoAoAoAoAoAoAoAoA0!!|!ERROR TIMEOU DF,-",",,"@<"1"$" $",-","'"'"@<"P2547l63 $")A)A;)AK)Ab)Ao)A})A)A)A))A;)AK)Ab)Ao)A})A)A)A*A*AC"C"@"|A"L"@"%%%DX"@"@"^"atastartata_thread_runatabus_threadd"i"P25P25a"P2547l63P25 #(-27<FP d'SpectecSDIO WLAN CardSDW-820e @ d' #(-27<FPsdmmc_mem_enablen6Aa|6AP6A6A ,6A@P 5"7A8A!$ #< #H #` #x # # # #pxa2x0_i2c_intr_subDg# g#EAEAEAg#lh#P25P25r#P25`i#l6h#P255d>X>5>~>=d>X>=>~>V|~>p}>V}>{> KAKA{>z>*KA!MAT@ z>y>Px>w>.KAA8w>,v>u>t>%  8  @!!@! ! #/ ''w0 g'' c0c LA!MAT@HTLA+LAz4LAALAz`LAgLA `LAgLA LAnLAuLA|LAuLALALALA@LALA@LALALALA!MAOA KAKAlLA!MALAH MA!MAT@MAMALA*MA?MA@IeIIFMAKMAI0I0EuLASMA^MAdMA@&II  IlMAtMAuLA{MA@"I0MAMALA-/MAMAMAMAMAMAMAMAMAMAMANAMANA6NA=NAMALNAMAbNAMAzNANA")NANAuE o@o @o @LANANANASA*KA!MAT@@& 3BI@NANA @(#0OAOATB zOA-OAAAOA2'EOAOAOAOAOAOAPALAOAPAPA'PAPALAOALA0PANAPAPAPAPAPAPAPAVVwhMAPAMAPAQAQA6NA)QA6NA4QA=QAPAFQAOQAP8soo P q q sMkltPAPAtt3hQAoQA hCQAQA h&FILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~9B SASASAASASA#P#\#t##P250#P25#l6#P255VAGVASVAdVApVAvVA|VAVAVAVAVAVAVAVAVAVAVAVAVA/A@d@q @c@c@2@ @?@ "@D@Q2@e@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@`1l703% bU bU b  2 @@5(#$XA   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u    :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F    u ;u )%u&5Fu 3 4u&6F  0 1  2 5D[$\\$\$_$`$P25_$l6Z$P25X$V$X$Pr3X@n$\n$,f$e$e$5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;<=>?@ABCDEOMPJQNRK !`A+`A/`AKA `A`A`A`A|$|$D}$ w$v$x$$$$$|$$$($uisdata_bio1W 1 Q  $ D$  % L $Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ !!(!D!F  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |5̜$aAXA2VZP~" `"'`{%150$bAXA5د$bAXA@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 0dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^d5$cAXA P@9WPurl_int_mii_write_regurl_int_mii_read_reg5$EdAXA B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn 5$dAXA$u$u$x$x$Pxmue_rx_loopmue_tx_preparemue_csr_writemue_csr_readmue_eeprom_getbytemue_read_otp_rawmue_mii_write_regmue_mii_read_regmue_dataport_writemue_chip_init5$fAXAF hF 5%fAXA%%T%%%%%%%%%%P2547l63%5%8AfAsysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrkAkAlA-lAClAllAlAlAlA mA mA lA 6mA 6mA 6mAWmAWmAWmAzmAzmAzmAmAmA!mA"mATHIS is A memory TEST pattern !)x%̪%d%%%%%l%l6 8P25 ##$%|%t%%%%%@ %%@<%%   @ @ @  0        @*  ) 2&&&&&&6&d&&&6&p&;&!&D6&&&&\.&6&D&l#&!&5&&&&&&@&#& &l7&&&$.&6&&D#& &5&&&&-&&&     ,/&'&7&4&$&`& &5PL&ZtA @6cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTPQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IXkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q`??]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽH ??DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTH ??DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@ ??DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_r/_@[ ,Κ;qLr!oADSgEmV1JBچ8{ Bieee80211_setmode@P ,    $ 0H`l     $ 0H`lieee80211_media_status , $0H`lieee80211_media_change   $0H`l  $0H`l_ieee80211_crypto_delkeyieee80211_crypto_registerieee80211_crypto_unregisterieee80211_crypto_newkeyRzA[zAezArzA|zAieee80211_crypto_setkeyieee80211_crypto_encapieee80211_hdrsizeieee80211_crypto_decapccmp_setkey8{A&& &&&& &ieee80211_hdrsize{A(&,&0&&h&8&P&Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_setkeytkip_decapT|Ap&h&`&&в&x&&ieee80211_hdrsizetkip_encap0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-|A&&&@&&&&ieee80211_hdrsizeieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_lateattachieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_updateAAAAAAAieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupfA bxm(x(w(x( bCA(89(49(@=( b)09(,9(@) b((9($9(@?)0T)\S) b((89(49(@ bCp =89(49(@ = b)Cp =89(49(@ = bsCp =89(49(@ = bC'89(49(@d''' bC((89(49(@̵(}E#(D(@AAA==A*ip_output(((<(\(x((0(((|(d(ȳ((l(t((|(((syn_cache_respondtcp_output @@@@@@@c)f)g)Xi)tcp_ctloutput)))))))`)))y)k))) )ԓ)D),)x)p)p)<))d))p)D)Ȫ)d))x)D)$))vtw_control_init""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwww )))x))4))4)))))))))p)d)) A)?A)LA)DB)XAP)cA)icmp6_reflecticmp6_redirect_input_icmp6_inputicmp6_errorin6_get_llsol_addrin6_update_ifa1in6_join_mcastgroupsin6_if_link_upin6_if_link_down^generate_tmp_ifidin6_ifattachin6_ifattach_loopbackget_ifidin6_ifattach_linklocalPb)P**L *\*Pb:ClD* **X@|6*Pb(,** @|,Pb)**@м*0T)\S)Pb, *̼*X@Pb<*Pb+x,Pb,*PbC =ȼ*̼*X@ =Pb)C =ȼ*̼*X@ =PbsC = *̼*X@ =PbgCX)+̼*X@+PbC,̼*X@,ip6_get_prevhdrip6_nexthdrip6_input(@AAA==(A*ip6_outputnd6_initnd6_optionsnd6_resolvend6_rtrequestnd6_na_inputnd6_ns_outputnd6_dad_timernd6_na_outputnd6_ns_inputnd6_dad_startin6_init_prefix_ltimesnd6_prefix_onlinknd6_prefix_offlinknd6_rs_inputnd6_defrouter_selectnd6_invalidate_prefixnd6_pfxlist_onlink_checkin6_tmpifaddnd6_ra_inputprelist_updatend6_prelist_addin6_ifaddt,+++,+,++|+$+P+++X+`+0,++sa6_recoverscopein6_setscopeDAAB9B9BA9B9BA9B9B9B9B9BAudp6_output ,D,,|,,8,8,,t, ,`,,D,(,,,4,,d,z)@l&@Ot(@l&@v&@4)@l&@O%@ %@Z#@l&@Al#@F.%@%@J"@P8"@l&@ $@ $@ $@ $@ N!@H !@X\ @ D @ . @ D @ (@bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>.'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>| 9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm 5I,0@Ap>,8>,P25P25D,P2547l63P255L,A5lS,A     !A  !@@@@AAA8A[A~A A A A A;5A.XA{AAAAA4-ARAuA5A6A A A 'A <DA ?aA ,~A -A A A A =3A :PA mA A"A6A$A A8DAPhA##   1 @x,Pt,y,x,x,y,x, ,y,x,,y, 22     * #hhu hhhA,,,AA A'A,(,<,XA,,\,U|AUAU2AU3AU1A, ,dg,AU5A8,ܠ,dg,,\o,<, xA{ A ,\o,, ,,,$ACAbAAAЮ,,,}A}A}0A,,,,,dg,vXAvAvAv Av Av An`XA,,dg,X9/A0,4,dg,,\o,dg,xor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zerod,L,,,,,X,,,h,P25A,,,,,,wsemul_vt100_output_c0c1A-`-4, -L,T--@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!AA"A(A.A4A:A@AFALARAXA^AdAAAjApAvA|AA AAAAAAAAAAAAAwsevent_copyout_events` --<-=-h&-P250-P25&-l6H'-P25ABCDEFGHIJKLMNOPQRSTUVWXYZR-I- J-P25Q-P25\J-l6J-P25rasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?,b&\b&įb&N@N@oP@P@                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(R@R@aR@)?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~PXP--TF--PNd-RR-CE-ST-NM|--CL-0PL-0RE-@RR-CE-ST-SLȳ-RR-CE-ST-ER-CE-ST-$+;XY@W@V@5-AdV@@ 9@\: @\:<@\:X@\:t@\:@-@-Ȗ@D-@\:@\:@\:8@\:p@d(;T@\:@\:@\:ė@\:@\:@\:@\:4@\:P@\:l@\:@\:@\:@\:ܘ@\:@\:@\:0@d-L@-h@ *;@T*;@\:@\:ؙ@p-@t*;@\:,@\:@܉9@\:dW@@ 9@p<; @x(;<@x(;X@`>;t@I;@-@-Ȗ@D-@0B;@C;@(;8@F;p@d(;T@p=;@F;@G;ė@|);@G;@G;@(;4@x(;P@x(;l@x(;@x(;@x(;@x(;ܘ@x(;@x(;@x(;0@d-L@-h@ *;@T*;@<;@HH;ؙ@p-@t*;@<;,@K;@܉9d@:@;d`Y@@ 9@- @(;<@(;X@(;t@(;@-@-Ȗ@D-@X-@(;@(;8@(;p@d(;T@t);@8(;ė@|);@*;@(;@D(;4@(;P@`-l@(;@(;@(;@-ܘ@-@-@\(;0@d-L@-h@ *;@T*;@4-@-ؙ@p-@t*;@@-,@(;@܉9d@:@;???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥd-4-$+;-;-;updatefatsUL^@5".MA. .. ddT^@@ 9@ . @Q.<@(;X@(;t@R.@\G.@hS.Ȗ@d2.@7.@9.@(;8@(;p@d(;T@t);@8(;@`+;ė@|);@*;@W.@D(;4@=.P@(;l@>.@X.@$>.@(;ܘ@H.@(;@\(;0@d-L@-h@ *;@T*;@5.@E.ؙ@F.@t*;@HH.,@DG.@܉9d@:@;AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z.p...nfs_sillyworker..H.; @q@q@q@q@q@pq@\q@Bq@&q@ q@p@p@p@p@tp@Rp@>p@(p@p@p@p@o@ ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  Tu@s@r@5x /?B6dr@@ 9@\: @\:<@\:X@\:t@L/@E/@%/Ȗ@0o/@l;t@$L/@E/@%/Ȗ@0o/@;/@*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?00W1;pX1;ffs_newvnodeffs_reload0000d0T0,00 ffs_syncx}@{@Pz@50A4A6dXz@@ 9@\: @\:<@\:X@\:t@@U1@<1@=1Ȗ@?1@T1@ U1@\:8@\:T@\:p@d(;@\:@\:ė@\:@\:@`0@\:4@\:P@\:l@\:@\:@\:@\:ܘ@\:@\:@\:0@1L@0h@ *;@T*;@\:@\:ؙ@ S1@t*;@\:,@\:@܉9@\:@x0@0@0(@$0Ԛ@0 @ 06d{@@ 9@p<; @x(;<@x(;X@`>;t@hT1@<1@=1Ȗ@?1@S1@(T1@(;8@F;T@p=;p@d(;@F;@G;ė@|);@G;@0@(;4@x(;P@x(;l@x(;@x(;@x(;@x(;ܘ@x(;@x(;@x(;0@1L@0h@ *;@T*;@<;@HH;ؙ@ S1@t*;@<;,@K;@܉9d@:@;@x0@0@0(@$0Ԛ@0 @ 06d}@@ 9@1 @d;1H@(G1<@;1X@@<1t@t<1@<1@=1Ȗ@?1@P0@P0@(;8@(;T@t);p@d(;@8(;@`+;ė@|);@*;@`0@D(;4@D1P@E1l@61@8H1@K1@Y1ܘ@0M1@P1@\(;0@1L@0h@ *;@T*;@x1@TQ1ؙ@ S1@t*;@U1,@TV1@܉9d@:@;@x0@0@0(@$0Ԛ@0 @ 04@50JBA6d<@@ 9@x(; @x(;<@x(;X@1t@l1@x(;@x(;Ȗ@x(;@x(;@x(;@(;8@(;T@t);@x(;ė@|);@x(;@G;@x(;4@x(;P@x(;l@x(;@x(;@x(;@x(;ܘ@x(;@x(;@x(;0@1L@l1h@*;@*;@\1@`1ؙ@1@*;@x(;,@x(;@܉9@*;ufs_inactiveufs_dircompactufs_dirgrow8,1p,1,1P-1t-101|61-1.1.15814A ...v141x1~1uao_putH1ubc_uiomove\1(1t11uvm_km_suballoc1X11uvm_unmap_removevmmapbsyB2@B2@D@@ @uvm_page_physloaduvm_physseg_unplugswap_offswstrategysw_reg_strategyuvm_swap_initswap_on|25|2522P25P2547l63P25|25|25Ԗ2P25P25P25`2\2225H2A5t2"ANetBSD52CA52QA:AA"A1AA,@A#7$wx@g`8@Gdeadcv5@3KA|25|25|25|25K3|2547l63P25M3P25P25P25P25P2547l63P25pu3u3BX25X253hr3{3pr3L3t3r3dr3Pr3L {3{3 t3s3xs3@v3u3pt3B.>B5>B<>BG>BN>BV>B_>Bi>Bq>By>B>B>B>B>B>B>B>B>B>B>B>B>B>B>B?B ?B?B?B%?B,?B3?B;?BD?BL?BT?B=B>B>BA >B>B>B>B">B=B=B=B=B=B=B=B @` A?BJBMAA?B?B?B vcache_reclaimvrelelholdrelelvcache_make_anonvwakeup@L:,:8::|:::d:r3:BB@BB@ BB@ BB@ BB@ BB@ BBx@ BBp@ BBh@ BB`@ zBBX@ lBBP@ _BBH@UBB@@KBB8@BBB0@5BB(@*BB @!BB@ BB@BB@BB@ AB@ AB ܜ@ ABԜ@ ABȜ@ AB@ AB@ AB@ AB@AB@ AB@!AB@"}AB@#tAB@$gABx@%]ABp@&PABh@'CAB`@(7ABX@)*ABP@*ABH@+AB@@,@B8@ -@B0@.@B(@/@B @0@B@1@B@@@@ @<@X@t@@@Ȗ@@@@8@T@p@@@ė@@@@4@P@l@@@@ܘ@@@0@L@h@@@@ؙ@@@,@H@d@@@@Ԛ@@ @(@8Bԝ@dܝ@@T:@(;@:X@:t@(;@:@:@(;8@(;p@(;T@:@:4@:P@L:l@T:@8:@(;@(;0@ :L@(;h@);@);@\:@:ؙ@:@t*;ė@(;d@ :@::@:::d@@ 9@d: @x(;<@x(;X@:t@|:@l);@l);Ȗ@l);@:@0:@(;8@(;T@:@0:@t:ė@|);@x(;@(;@x(;4@x(;P@x(;l@x(;@x(;@x(;@x(;ܘ@x(;@x(;@x(;0@x:L@(;h@ *;@T*;@:@x(;ؙ@:@t*;@:,@(;@(;@*;genfs_suspendctl<&;';<&;&;<&;';5/;CBlayer_bypassd@@ 9@p<; @x(;<@x(;X@`>;t@I;@l);@l);Ȗ@l);@0B;@C;@(;8@F;p@d(;T@p=;@F;@G;ė@|);@G;@G;@(;4@x(;P@x(;l@x(;@x(;@x(;@x(;ܘ@x(;@x(;@x(;0@<;L@T=;h@*;@*;@<;@HH;ؙ@HK;@*;@<;,@K;@܉9d@:@;devclsdeviocdevoutdevindevwaitdeviodevopn5W;fAdkdumpv;{;tt;Tq;p;lo;n;v;{;y; y;Tq;P2547l63n;HBHB&HBHBEFI PART(s*K>;MA2IчH B|nQn- q+ BZIчHA|nQn- q+ASFU0eC쬯AIчHr[BIчHcEB-чHIB-чHIBSFH0eC쬨HBS'@ )ѸIB*1@ )ѸJB1x )Ѹ JB3Dh&JB=rGy=iG}JB;;;p;Ȟ;P2547l63P25;;̙;Ȟ;P25;P25;|25;;;P2547;3P25;P25P25P25P25P2547l63P255@0;;;q3Ȩ;\;;;r3;t;Ա;P25P25P25P25P2547l63P25JB;;;q3<;; ;;r3_bpf_mtap_softint_init5Ի;JBKB5;KBifaddrpref_ioctld n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; (@t; )@t; *@t; +@0 ,@vH-@vH.@vH/@vH0@vH1@vH2@vH3@vH4@vH5@vH6@vH7@vH8@.9@.:@.;@.<@.=@.>@.?@. `!]!`!]"`!]#`!]$`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jrt_initrt_timer_initmZV%[Ag%=C+ˮ{0w-0 jB;rt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0 c<<@<A@@@8@@A0@UYB(@AA @]YB@ @@@@U@@@@@@@@@@EAز@-@в@c@Ȳ@=PA@d@@fZA@4[A@n[A@\A@<`A@aA@bA|@bAt@cAl@HdAd@dA\@fAT@fAL@db bb\bbbHbbbhbjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG'[B B.[B1[BHB4[B9[BAMAr[B<[BB[BA AG[BHBL[BJBJBcEBIBU[B/AZ[B`[Bd[Bl[Bp[BIBv[BIBJB JBoAgnts=d==d[B fA(=[B8=[B8=TA=T@L=[BԸ=[BȢ=ܳ==rbmn=p===ܲ=d([Btcid==L=====(== yekdм===d [Bd[Bd<\Bd,\Batadx==$=ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/d\Bloobx==@=yara====|=d \BstrtoullstrtollstrtoulCopyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALLNetBSD 9.0 (INSTALL) #0: Fri Feb 14 00:06:28 UTC 2020 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL @(#)NetBSD 9.0 (INSTALL) #0: Fri Feb 14 00:06:28 UTC 2020 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL 9.0NetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failediso partitionbad sector table I/O errorbad sector table corrupted: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_set_power: bogus power statescoop_pcic_write: bogus registerpxapcic_scoop: GPIO controller unable to acquire bus. error=%d output write failed. error=%d ioexp%s: not configured. can't map bus space couldn't establish power handler zssp%s: not configured zssp: zssp_ic_send: invalid IC %d Sharp Zaurus frame bufferSharp Zaurus LCDzlcdstdw100lcd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctlcouldn't register event handler zkbd: pseudo power management module apmdevifzapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbuslr, rrx, %s r%d, %s #%dthumb insn , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]und%s %08x oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-aquiet-q-v-x%s: curaddr %#lx not in range_bus_dmamap_sync: mix PRE and POST_bus_dmamap_sync: _BUS_DMA_BUFTYPE_INVALID_bus_dmamap_sync: map %p: unknown buffer type %d _bus_dmamem_map: size botch%dKB/%dB %d-way %s L%u %cI%cT Unified cache %dKB/%dB %d-way L%u %cI%cT Instruction cache %dKB/%dB %d-way %s L%u %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-SARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %ppmap_pv_protect: page not pv-tracked: 0x%lxfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)scsiverboseperiphtapeprinterprocessorwormcdromopticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storagescsipi_dtype: impossible device typescxsplWARNING: not enough memory for scsipi_xfer_pool unable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer %02x DEFERRED ERROR, key = 0x%x , requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal), data =Sense Error Code 0x%x at block no. %d (decimal)request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedsearch returned equalverify miscompareunknown error keyscsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter %s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d), 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueingtagged queueing ATA illegal length indicationATA volume overflowATA command abortedunknown error code %d %s(%s:%d:%d): wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: PIO mode %d rejected, falling back to PIO mode 3 wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out %s:%d:%d: %s error (0x%x) wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: driver failed wdc_atapi_get_paramswdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unable to allocate periph for drive %d wdc_atapi_scsipi_request %s:%d:%d atapiscsibusdetscsinitq: SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info target %d lun %d: <%s, %s, %s> %s %s%sscsibus at %s channel %dscsibuswaiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X GENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA drive %d: <%s, %s, %s> %s %s: %d targets atapibus at %satapibusALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.02Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25read_cd_capacity: extra large block size %u found - limiting to 2kByte optical mediaMMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct NEC CD-ROM DRIVE:260cache synchronization failed no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectorsdrive offlineunformatted mediastandby immediate standby immediate command didn't complete standby immediate not supported wd_standby: status=%s %s: (error not notifieddevice faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx wdstart1: try againwdstart1: bad return code from ata_bio()wddump: try againwddump: polled command has been queuedwddump: unknown atacmd code %dwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xtrim command didn't complete wd_trim: status=%s wdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed flush cache command didn't complete wd_flushcache: status=%s ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEFORCE_LBA48quirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors WARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d wd_setcache command not complete wd_setcache: status=%s address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS%s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq recalsetmultiatacmd_to48: illegal 32-bit command: %d%s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: not ready, st=0x%02x, err=0x%02x drive fault error (%x) atabus at %swd at %s drive %d%s: unknown child %patasplatainitqcan't alloc drive array %s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't create task thread "%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %dcouldn't alloc memory (sdmmc function) sdmmc_set_relative_addr: SMC_CAPS_SPI_MODE setsdmmc_select_card: SMC_CAPS_SPI_MODE setcouldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d unknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x %s: %s failed with error %d SD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) SD card status: unknown bus width %d-bit, C%d, U%d, V%d, A%dcan't execute SD tuning can't get SD status: %d write-protected Default/SDR12High-Speed/SDR25SDR50SDR104DDR50: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmctask%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_hook: malloc failedconfig_connect: malloc failedconfig_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxaippxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented stray interrupt %d : Interrupt Controller intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostNot supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d lcd_free on active screen Stray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacunable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL pcmciabusunable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout couldn't start dma xfer. (error=%d) unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledreal mode interface already connectedinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentunknown error codeAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! Cannot allocate cfe entry CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for pcmcia_check_cis_quirks: malloc pfpcmcia_check_cis_quirks: malloc cfeSVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-EthernetDYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciausbevt: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hcusbtask-drunable to create task thread: %s usb_create_event_thread taskusb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s usb at %spre 1.01.13.03.1usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usb_desc_iter_next: bad descriptor usb_desc_iter_next: descriptor length = 0 usb_desc_iter_next: descriptor length too large usbdetusb_detach_waitold: didn't detach usbverbosevendor %4.4xproduct %4.4x port %d configuration %d interface %dusbdevifserialnumberusbifif%x.%02x%s (%#04x) %s (%#04x), class %d/%d, rev , addr %dusbdlyout of data0 lengthiface descusbd_fill_iface_data: bad descriptor(s): %s usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDusb error on tx: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) close pipe %zu: %s watchdog timeout pipe abort failed: %s usb error on intr: %s open rx/tx pipes failed: %s rx list init failed tx list init failed if_initialize failed: %d Ethernet address %s usbnetillegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d hub not fully initialised, but child deleted?multiple%s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint cannot open interrupt pipe port %d power on failed, %s uroothubuhubuhid at %s reportid %d%s, iclass %d/%d could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidbusuhidev_intr: bad repid %d uhidev: input=%d, output=%d, feature=%d uhidreauhiddetuhid%s: was console keyboard multiple key code arrayskey codes not on byte boundarykey code size != 8too many Variable keysbad modifier sizeattach failed, %s This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). ukbd%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s %s: Unknown state %d%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Get Max Lun failed: %s umassdetusing %s over %s quirk init failed endpoint not found %u/%u/%u unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers isdata not configured command protocol=0x%x not supported bus attach failed ATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumassuisdata_exec_command: large datalen %d uisdata_exec_command: bad command 0x%02x uisdataex%s: ATA_POLL not supported uisdatablumass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbcan't allocate link for drive %d %s: reset failed failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint auedet%s: EEPROM read timed out if_aueno union descriptor no data interface setting alternate interface failed unexpected endpoint could not find data bulk in could not find data bulk out faking address cdcedetif_cdcecouldn't get ep %d cuedet%s: read MAC address failed if_cue%s: warm boot, no firmware download %s: cold boot, downloading firmware %s: failed to load code segment: %s %s: failed to load fixup segment: %s %s: failed to load trigger segment: %s loading firmware failed kuedetcould not read Ethernet descriptor if_kue%s: %s: bad register %04x failed to get interface, err=%s couldn't get endpoint %d urldetif_urlmedia change failed read PHY failed can't read rxmodeaxedetfailed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axe%s: packet length %u too short %s: rx_cmd_a: 0x%x %s: invalid packet length %d %s: packet length %d too long%s: reg = 0x%x: %s %s: not ready %s: timed out LAN7500LAN7800failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints muedet%s: PHY not ready failed to initialize chip %s id 0x%x rev 0x%x mac-addressfailed to read MAC address if_mueudavdetif_udavunable to flush cache lddrain%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x detect auto increment bug, try again wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: cleaning outstanding rssadapt descriptor for %s %s: tx rate %d -> %d (%d) %s write fid %x failed %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u failed to allocate %d bytes on NIC tx buffer allocation failed timeout in alloc %s: interface not running %s: device timeout LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list if_initialize failed(%d) Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration dp8390_start: no header mbuf%s: NIC memory corrupt - invalid packet length %d device enable failed ne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete where did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550a, working fifost16650, broken fifost16650a, working fifons16550, broken fifons8250 or ns16450, no fifotl16c750, working fifons16750, working fifoAu1X00 UART, working fifons16650, no ERS, working fifoOMAP UART, working fifoIngenic UART, working fifoTegra UART, working fifoBCM AUX UART, working fifois_consoleforce_consolecan't re-init serial console @%lx txfifo disabled unable to allocate ring buffer 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s channel %d: reset failed for drive 0 drive 1__wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xferlost interrupt%s:%d: %s %s:%d:%d: %s type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardlRoot hubOHCI root hubohci_device_isoc_abort: early return WARNING: addr 0x%08lx not found ohci_setintr: 0 interval %s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted , legacy supportohcixferOHCI version %d.%d%s unsupported OHCI revision SMM does not respond, resetting reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilcrypto_core_constant32[0] == le32dec(&sigma[0])crypto self-test failed: %scrypto_core_constant32[1] == le32dec(&sigma[4])crypto_core_constant32[2] == le32dec(&sigma[8])crypto_core_constant32[3] == le32dec(&sigma[12])block[i] == le32dec(&out[i*4])expand 32-byte kinvalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher not enough data in following buffer, m_len %u need %u [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt [%s] Discard frame due to countermeasures (%s) TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: too short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table 0x%p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %s: free all nodes in %s table %s %s table %s: %s[%u] still active ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s: scan set:%s%u start chan %u passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country infokey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup inital BSS node%s: no memory for AID bitmap! %s: no memory for TIM bitmap! %s %s table, inact %u Cannot allocate key index map with %u entries scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %zu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %d (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlinpcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechoICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailableselectedreserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblist(unknown)TCP: invalid wscale %d from %s, assuming %d tcpipqepltcp_pulloutofbandsynpl%s: impossible (1)%s: impossible (2)m_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachablerfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesglobalmaxholesglobalholeslocal_by_rttdropiss_hashabcaggressivemsltremoteremote_thresholdvtw%s: af %dtcp6inet6newrenocubic%s: could not allocate %zu bytes for hash anchors%s: could not allocate %zu bytes for fatp_t array%s: could not allocate %zu bytes for vtw_t arrayudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_umaxtriesnd6_mmaxtriesnd6_useloopbacknodeinfond6_maxnudhintmtudisc_hiwatmtudisc_lowatnd6_debugnd6_drlistnd6_prlistmaxqueuelen%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: the prefix length of an existing (%s) autoconf address should not be changed %s: addmulti failed for %s on %s (errno=%d) in6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlprefix ioctls are now invalidated. please use ifconfig. %s: %s marked tentative %s: %s marked detached in6_if2idlen: unknown link type (%d) in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: never found a good ID %s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address in6pcbpl::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6accept_rtadvrtadv_maxroutesrtadv_numrouteskeepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedrr_prunev6onlyauto_linklocaladdctlpolicyuse_tempaddrprefer_tempaddrtemppltimetempvltimemaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxifprefixesmaxifdefroutersmaxdynroutesip6_init%s: off < sizeof(struct ip6_hdr)%s: m == NULL%s: packet to an unready address %s->%s pim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludgeregen_tmpaddr: failed to create a new tmp addr, errno=%d nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 which needs %lu scope error in prefix list (%s) scope error in router list (%s) nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: Cannot enable an interface with a link-local address marked duplicate. %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s %s: preferred lifetime(%d) is greater than valid lifetime(%d) %s: %s/%d is already on-link %s: failed to find any ifaddr to add route for a prefix(%s/%d) on %s %s: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d rtpref: impossible RA flag %x %s: %s/%d is already off-link %s: failed to recover a prefix %s/%d from %s to %s (errno = %d) %s: failed to delete route: %s/%d on %s (errno = %d) %s: lladdrlen mismatch for %s (if %d, RS packet %d) %s: called unexpectedly (forwarding=%d, accept_rtadv=%d) nd6_defrouter_select: more than one router is installed %s: failed to make %s/%d offlink on %s, errno=%d %s: failed to make %s/%d offlink, errno=%d %s: failed to make %s/%d onlink, errno=%d nd6_prelist_remove: negative count on %s %s: failed to find a good random IFID %s: failed to find a unique random IFID %s: ifa update succeeded, but we got no ifaddr nd6_defrtrlist_del: negative count on %s %s: src %s is not link-local nd_ra_input: lower CurHopLimit sent from %s on %s (current=%d, received=%d), ignored %s: invalid option len %d for prefix information option, ignored %s: invalid prefix len %d for prefix information option, ignored %s: invalid prefix %s, ignored %s: failed to make the prefix %s/%d on-link on %s (errno=%d) %s: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p %s: IFID undefined (%s) %s: invalid prefixlen %d for %s, ignored %s: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: %s is already configured %s: failed to make ifaddr %s on %s (errno=%d) %s: failed to create a temporary address, errno=%d %s: bogus mtu option mtu=%lu sent from %s, ignoring %s: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring %s: lladdrlen mismatch for %s (if %d, RA packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d addr 0x%xiicintr: I2C bus unable to create intr thread i2c-indirect-configi2c-child-devicescookiecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x %s at %s addr 0x%02xi2c-indirect-device-whitelistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' WARNING: intr handler list not empty WARNING: proc handler list not empty i2cexec,i2c_bitbangi2cexeciic at %smii_attach: phyloc and offloc specifiedmiimii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverbosemiiautmii_phy_setmedia: MASTER on wrong mediaHomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXcouldn't establish power handler: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX, BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyno media presentDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance no media present exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX, LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_common_attach: no memory kbdmux %d: console (%s, %s emulation), using %swsswscreen %d deleted wsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %dOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux_getmux: no memory for mux %d wsmuxwsmux: attach out of memory %s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] cd9660utf8_joliet%/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. doscheckpath(): .. not a directory? msdosfs_sync: rofs modmsdosfsRRaArrAamsdosmsdosfs_write(): bad file typerename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad v_usecount%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%s%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inodefile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dffs_indirtrunc: bad buffer sizeitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on listffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %d%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsdoclusterreaddoclusterwritedoreallocblkslog_changeoptorg.netbsd.kauth.systemffs_modcmd: can't listen on system scope. appleufsffsinoffsdino1ffsdino2, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: lost blocks %lld files %d %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_ioctl not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s missing NUL in namenot roundednull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageanonpllivelockuao_getpageuao_getuao_create: hashinit swhash faileduao_create: swslots allocation faileduaoeltpluao_put: strange, got an out of range flush 0x%jx > 0x%jx (fixed) uao_put%s: impossibleuao_detubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object%s: error=%d udv_detachudv_faultudv_attachflt_noram5flt_pmfail1flt_pmfail2anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpgloanagainloanzeroloanuopguser_va0_disablevmmpeplvmspplvm_map%s: kernel object %p %p vmmeterloadavguvmexpuvmexp2maxslpuspaceidlezerominaddressmaxaddressthread_guard_sizeuobjwirepguvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocateduvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: Tried to unplug unknown range ractx%s: swapdev not in list%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning of swap...stopping swap on %s failed with error %d uvn_fp1uvn_fp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncerfork aiodoned%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_ticksclockinterruptCondition variable%.*spid %d (%s): %s write of %zu@%p at %lld failed: %d cpu%dfdcloseincrease kern.maxfiles or MAXFILESfdfilefiledescfile2dup2EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSexecargsshould not happenpspawnlwpwaitkernel mapping failed %d netbsdinit died (signal %d, exit %d)orphaned traced processincrease kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx softintpserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)swapperWARNING: module error: built-in module %s can't find builtin dependency `%s'built-in module %s prerequisite %s failed, error %dbuilt-in module %s failed its MODULE_CMD_INIT, error %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEunload requested for '%s' (%s)module `%s' not foundmodule `%s' busy (%d refs)cannot unload built-in secmodel module `%s'cannot unload module `%s' error=%dunloaded module `%s'module `%s' declined to be auto-unloaded error=%d%s: builtin module "%s" init failed: %dmod_unld/stand/%s/%d.%d/modulesbuiltin %s failed: %d moduleautotimemodunload%s: %dmodule `%s' pushed by boot loader already existsduplicate bootlist entry for module `%s'unable to load `%s' pushed by boot loader, error %dunable to fetch_info for `%s' pushed by boot loader, error %ddependentuse -f to reinstate builtin module `%s'%s module `%s' already loadedout of memory for `%s'cannot fetch info for `%s', error %dmodule `%s' has invalid class %dmodule `%s' built for `%d', system `%d'forced load, system may be unstableincompatible module class for `%s' (%d != %d)dependency name mismatch (`%s' != `%s')module with name `%s' already loadedcircular dependency detected for `%s'required module name `%s' longer than %dself-dependency detected for `%s'recursive load failed for `%s' (`%s' required), error %dunable to affix module `%s', error %dmodule properties failed for %smodcmd(CMD_INIT) failed for `%s', error %drecursive load causes duplicate module `%s'module `%s' loaded successfullyLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for %skern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfmutex_init: impossible typeMutexmutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) %s: %s suspension %s (delegator %s) removed by %s classresume failed Powering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: class suspend %s: driver suspend %s: bus suspend %s: suspend enter %s: suspend exit Flushing disk caches: Suspending devices:%s: bus resume %s: driver resume %s: class resume %s: resume enter %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueprocplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s rasplimitplpstatsplcurprocpaxflagsrlimitcputimefilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitrnd: source "%s" failed continuous-output test. rnd: source "%s" failed statistical test.rnd: disabling source "%s". rndsrcrndsamplernd: seeded with %d bits printfautoconfrnd: bad seed length %d rnd: bad seed checksum requesting entropy from dead rndsink: %prndsink %p in unknown state: %drndsinkdestroying dead rndsink: %pcacheht_timebalance_periodaverage_weightmin_catchtimesoftintskpreempt_priupreempt_prirunqueue pullrunqueue pushrunqueue stayrunqueue localizeowner/count : %#018lx flags : %#018x Reader / writer lockrwlocksigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes softdissoft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsedisk%s%lluswap dumps on %suse one of: %s[a-%c] none halt reboot md0 (default %sdump device (default %sb)file system (default %s): use one of: genericunknown device major 0x%llx device %s (0x%llx) not configured root on %scan't determine root device sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesetrunnable: lwp %p state was %dWARNING: negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d %s: rnode %p wrong version sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_mspooloverpooloverseer/%d@%dthreadpool job %p ran after destructionpoolthrdpoolthread/%d@%dthrdplcrthplthrddeadjobptimerplptimersplnanoslppid %d attempted to set the (obsolete) kernel time zone callout_init_cpu (2)late/%ucalloutwait/%utstilepltstileturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time uidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrttsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s.%d, %s dvl_nlock %d dvl_nwait %d dv_flags %x %s with registered handlersdevice-attachdevice-detachcfgmiscdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_detach: forced detach of %s failed (%d)config_defer: can't defer config of a root deviceconfig_attach: allocation of device softc failedFound %s (root)%s at %sWARNING: power management not supported root device %s not configured done. WARNING: %d error%s while detecting hardware; check system log. detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcprng %s: reseeding with partial entropy cprng %s: NIST Hash_DRBG reseed failedNIST Hash_DRBG failed self-testurandomarandomcprng %s: NIST Hash_DRBG instantiation failedcprng %s: creating with partial entropy sysctlcprng %s: NIST Hash_DRBG failedureadc: non-positive residureadc: non-positive iovcnt%s: block majors exhausted%s: character majors exhaustedwrit%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and partition table is fullno raw partition and disk reports bad geometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitdisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table type KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpusetkcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-2048kmem-4096kmem-8192kmem-16384kmem-8kmem-16kmem-24kmem-32kmem-40kmem-48kmem-56kmem-64kmem-80kmem-96kmem-112kmem-128kmem-160kmem-192kmem-224kmem-256kmem-320kmem-384kmem-448kmem-512kmem-768kmem-1024not modular%s error: %s,%zu: %s lock address : %#018lx current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) page %p, nmissing %d, time %u %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u%s: [%s] ph %p poolid %u != %u%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOL CACHEPOOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer entry uncontended %llu contended %llu cache layer empty groups %u full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p empty cache groups: pool item size %zu too large, use a custom allocator(null)Skipping crash dump on recursive panic panic: [% 4jd.%.*ld] %s: table is full - %s %s: table is full autoconfiguration error: exclusive accesspsrlzspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclocvxchicvcrosscallunicastxcallxcall/%uaio_process: invalid operation code aioworkaiodoneaio_jobs_poolaio_lio_poolposix_aioaio_listio_maxaio_maxsys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s compat_80mqmsgplposix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsocketttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutftkstatninnoutcanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_streamseqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)offset %04d: %s: too short mbuf chain (%u < %u) %s: cannot read header ARP: AddressType = %u(ETHER) IEEE802) unknown) ARP: Protocol Address Format = %u ARP: Protocol Address Length = %u ARP: H/W Address Length = %u ARP: Operation = %u(REVREQUEST) REVREPLY) INVREQUEST) INVREPLY) Cannot parse. Cannot read payload ARP: Ether Src = %s ARP: IP Src = %s ARP: Ether Tgt = %s ARP: IP Tgt = %s ICMP: Type = %u(Echo Reply) Destination Unreachable) Source Quench) Redirect) Time Exceeded) ICMP: Code = %d ICMP6: Type = %u(Packet Too Big) Parameter Problem) Echo Request) MLD Listener Query) MLD Listener Report) MLD Listener Done) Router Solicitation) Router Advertizement) Neighbor Solicitation) Neighbor Advertizement) ICMP6: Code = %u TCP: Src = %u TCP: Dst = %u TCP: Seq. = %u TCP: Ack. = %u TCP: Header Length = %u TCP: Flags 0x%02x : FIN SYN RST PUSH URG ECE CWR TCP: Windows Size = %u TCP: checksum = 0x%04x TCP: Urgent Pointer = %u %s: cannot read TCP option TCP: OPTION: NOP TCP: OPTION: MSS = %d TCP: OPTION: wscale = %d TCP: OPTION: SACK OK TCP: OPTION: TIMESTAMP = %u, ECR = %u TCP: OPTION: unknown (%d, len = %d) UDP: Src = %u UDP: Dst = %u UDP: Length = %u IP: Version = %u IP: Header Length = %u IP: ToS = 0x%02x IP: Packet Length = %u IP: ID = %u IP: Offset = %u IP: Flag 0x%04x (reserved) IP: Flag 0x%04x (evil flag) IP: Flag 0x%04x (don't fragment) IP: Flag 0x%04x (more fragment) IP: TTL = %u IP: protocol = %u(%s) IP: checksum = 0x%04x IP: Src = %s IP: Dst = %s IPv6: Version = %u IPv6: Flow INFO = 0x%07x IPv6: Payload Length = %u IPv6: Next Header = %u(%s) IPv6: Hop Limit = %u IPv6: Src = %s IPv6: Dst = %s Cannot read option IPv6: Stripped Hop-by-Hop SPPP: Address = %d(ALLSTATIONS) SPPP: Protocol = %d(LCP) PAP) CHAP) IPCP) IPV6CP) IP) IPv6) MULTICAST) UNICAST) Keepalive) No parser for address %d, protocol %d %s: too short mbuf chain (%u, %u) PPPoE: Version = %u PPPoE: Type = %u PPPoE: Code = %u(PADIPADOPADSPADTPPPoE: Session = 0x%04x PPPoE: Payload Length = %u No parser for PPPoE control frame. Unknown PPPoE code. ETHER: DST = %s ETHER: SRC = %s ETHER: TYPE = 0x%04x(PPPoE) ARP) IPv4) No parser for AF %d IPv6 Hop-by-HopICMPIGMPTCPUDPESPAHICMP6unixposixsemmaxpsemksemsomaxkvasbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadunpgcuipc_init %duipc_usrrequipc 4inflightdeferredbuf mem pool index %dforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbflushbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestedcachegcncachenchinit %dnamecacheentries scannedentries collectedover scan targetunder scan targetforced reclaimsnamecache_statscwdidirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.fstypesmagiclinkspnbufpllf_findoverlap: defaultlockfchrooted pid %d uid %d (%s) detected outside of its chroot namei_simple_convert_flags: bogus sflags /../earmzauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dot%s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system failedunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... ILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFELOCKSWORK TEXT EXECMAP WRMAP WRMAPDIRTYONWORKLSTDIROPfiledelaydirdelaymetadelayvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dfdesckernfsafsfstchgfstcnt%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvcachevdrainvdrainwt%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-namexattr-valxattr-listsystem.user.security.trusted.vop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad oplayerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_ioctlspec_read typespec_write typespec_fdiscard: not a device spec_close: spurious pgrp refspec_close: not specialdev %llu, %llu spec_node_destroy: corrupt hashfictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) raidframe%s: blkno (%llu) + size / DEV_BSIZE (%zu) > sc->sc_size (%llu) %s at %s (%s) deleted dkdrn%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdcgdvmkcorevmfsvmwresvntfsext2fsmdidle%s: cfattach_attach failed %d %llu %uurandom%urndtemprndctxrndpseudoopen hardopen softbpfbpf_mcpybpf_change_type%s: softint_establish() failed%s: no bpf_if found for %smaxbufsizepeersbpfattach%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#%slink#%huif_ifqmaxlendropsifnetifasdl%s: could not attach sysctl nodes sndqrcvqif_detach: WARNING: AF %d not purged UPDOWN%s: lost link state change %s too many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %s%s: can't handle af%d ether%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_loopifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedpfilpktqsyncpktqrenqMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find our annotation rn_delete: couldn't find us radix already initializedrn_init: radix functions require max_keylen be set rn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutekeeplog_movementslog_permanent_modifylog_wrong_iface%s: %s not ready arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s %s: ouch, empty static llinfo for %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: Extensionsorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d curtainusermountuser_set_cpu_affinityextensions_modcmd::fini: secmodel_deregister returned %d Traditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionscryptofssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadzfstprofisvvideohdaudiouhsorumpblknpfdtvfilemoniscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmicttyphysconptcqmsofconsfdtunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseulptraidugenucomuriouscanneropenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomsysmondmoveriosscomksymsepcomtslcdtwensmbwdcpxapcicpxamcisdmmcbuswskbddevusbuswsemuldisplaydevreportiddriveconfigurationproductchannellungpiobuskbdmuxcontrollerindexdackirqintrbaseKernel RNG "%s" monobit test FAILURE: %d ones Kernel RNG "%s" poker test failure: parameter X = %lld.%lld Kernel RNG "%s" long run test FAILURE: Run of %d %ds found Kernel RNG "%s" runs test FAILURE: too few runs of %d %ds (%d <= %d) Kernel RNG "%s" runs test FAILURE: too many runs of %d %ds (%d >= %d) unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs30%llostringpropstng<>&plist version="1.0"?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl %s %s SIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... kern.driversinvalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1scosolarissunossvr3svr4ultrixffs@5VBVbNVVV ]V@VhVqV V6V ^TVVVVVVVք W@W&W4WKW@lWc&RWWWWuWW%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedforcemount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdupbnorripbgensbextattbnojolietbnocasetransbrrcaseinsYY_V hY^T VVV TBV_=T@YYYZZZZ Z usage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.YY_V hY^T VVV TBV@_1kV@T\ =T@NVbo:mount table fullincorrect super blockspecified device does not match mounted device%s on %s: %ssoftdepbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorYY_V hY^T VVV TBV@_=T@usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacYY_V hY^T VVV TBVT_=T@eea0e e@eeeee,e  @cced dd "d@recvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s%s: can't read disk label; disk type must be specified%s partition type is not `%s'rmmmnJnnnnno+o?o_ooooop=p]pppp q0qWTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdownSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%llunot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY`sѭ$Llخ 2ZzүUPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%d%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspechw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfR3;***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20150912NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (ftp_debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottle'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Receiving HTTP reply: %sInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'fetch_ftp: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime] [-r retry] [-s srcaddr] [-T dir,max[,inc]] [-x xferbufsize] [[user@]host [port]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u URL file [...] ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)xsignal_restart: called with signal %d %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. loginmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. ftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamNetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gz4HS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndadbticmsovb|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberrabetbhfprdldvcupndipausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i$!$#, $9;$A;L$MV$e$t|$,$ $;Ǻ$־;$߾;$;^$ $z$\$;Ȣ$)@$2 $<M$Yf$kf$|V,$e+$*$+$ѿǺ)$ڿ;G$;F$V`$e_$ ;^$#P$5Ǻ]$A;{$M;z$&U"NAME=&cuWy*P)>.26?@DLPVap|        !"#$%&'  ycU1K]ˆm y*P)>.26?@DLPVap|abr5q}oa-a!)k]y*P)>.26?@DLPVap|Ky`PQU----------------------------------- - --------------------  @//tmp/usr/var0$$l$L$*3:CNY GPT part - Details for index yRc&RWWWǝ.?WuWWh QLL!XWXYW=WJM5NPQYJqLJN;JkJa[M\a[Z5]RKWKGKK[Kycc& .k  SFH0eCJSFU0eC6Hah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+|nQn- q+|nQn- q+,7|nQn- q+EN=rGy=iG}Z;Mt?epmWC 3KOO{yD<#*=(3Dh&c\ M}--чH.-чHZIчH IчH&IчHk'2IчHyBS'@ )ѸN*1@ )Ѹp1x )Ѹ hKlU`Ur[vwErxwmg5uQg?glmEmimmykka)uzh-͊}q ij)p9o)nnkz "5Mn\)Alfv /bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages/sbin/halt -q/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeNoneOnOffunchangedDelete?reinstall sets forupgradeNetBSD/zaurus 9.0 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksaverage file size (bytes)mount point (or 'none')secMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberSelect file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.0 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.0 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.0 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.0 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. Available CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.0 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.0 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesGigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountRemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change it's size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionInstalling boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:psysinst: screen too small zaurusxfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgcdn.NetBSD.orgftp dirpub/NetBSD/NetBSD-9.0ftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/9.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %stmpfs%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s/sbin/newfs/sbin/newfs -V2 -O %d/sbin/newfs_lfs/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fsmount -rt msdos %s /mnt2/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%sprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'raidctlvndconfigcgdconfigdkctlrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700gamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%*s -%*s : %s%*s : %llu %s%*s : async noatime nodev nodevmtime noexec nosuid log noauto %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /dev/r%saNetBSD9/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s /dev/%s%cfictiousdisklabel -r %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:524: internal error%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%%zu %s%-35.35s %c %s %-37.37s %s %sdlsize=%lld ptsize=%lld ptstart=%lld %-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges%s_%lli@%lliNAME=%sStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headergpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1108: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1070: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt label -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sv7sysvv71kv8otherhpfshfsjfs2appleufsminixfs3vmfsvmwresvefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockio%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2069: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2036: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2159: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2164: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1716: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1746: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI Boot;***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipe6'-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu ping6: wrote %s %d chars, ret=%d --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000getaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmaprefusedunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s SuccessRefusedIPv6 addresscontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1=w=Odhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_getxsocketif_discoversplitvadd_environparse_optiondefault_configread_configbzDc2deLfgh"ijklmnop0qrsDtuvwxzSyAB*CD1E"F;GEH>I8JOKVL;M_NeOnP{QdS9TUVWXZ146|c~} %U%%"( 7@HPZgq$B~va a A A rt_new0w w rt_buildrt_delete- - P}iE}8+i XFB$Bumake_envscript_runreason0123456789abcdefdhcp_envoptionCn" < ^ }    #!D!o!!!!"="f"""""" #&#L#m###### $ $>$S$i$z$S$$$$S$$$$%5%[%o%%%%%%%%%&##%'&E&l&&&&&'.'T'j' #''if_opensockets_os;((if_initrtif_ifa )( PT@P HEPT$ @DCread_leasedhcp_openbpflog_dhcp111c1dhcp_bind1 011'/1* 1dhcp_start1dhcp_initdhcp_handledhcpdhcp_readbpfdhcp_readudpdhcp_recvmsgdhcp_dumpipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_rtprefipv6nd_applyraipv6nd_expireraipv6nd_handledataipv6nd_recvmsgipv6nd_handleraipv6nd_sendrsprobeipv6nd_startrs1BBBB1=8=B =B B0BDB[BfBrBBdhcp6_checkstatusokdhcp6_openudpdhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrequestdhcp6_startrebinddhcp6_writeleasedhcp6_recvifdhcp6_recvdhcp6_recvmsgdhcp6_start1 '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_dump/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.6--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.6 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.6 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix lenoption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbuf(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %saddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleteddeleting - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed index uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rt%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetap/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated lease%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: extending DHCPv6 lease%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: ignoring unicast option as not masterdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f seconds%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: DHCPv6 DAD completed%s: %s received from %sINFORM6ITIMEDOUTBOUND6RENEW6REBIND6REBOOT6TIMEOUT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: failed to request information%s: failed to request address%s: failed to confirm prior address%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: DHCPv6 lease expired%s: no advertising IPv6 router wants DHCP%05d %s%s: delaying DHCPv6 soliciation for LL addressSTOP6RELEASE6%s_dhcp6DUMP6Unspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BS$ S$ S$ S$ % S% T1% I% Se% n}% T% S% BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~S THP TLPSSSSSTS n@TSXVT/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidfull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-LR1050GBASE-SR50GBASE-SR256GBASE-R4100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-FR8400GBASE-KR4400GBASE-LR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist